Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

3,187,669 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-CPNE1 (aa 250-537) polyclonal antibody
 
Resource Report
Resource Website
Creative Diagnostics Cat# DPABH-05291, RRID:AB_2521166 CPNE1 mouse, human WB, IHC-P unknown rabbit AB_2521166 Creative Diagnostics DPABH-05291 2025-08-19 10:25:17 0
CD222 Antibody, anti-human, Biotin, REAfinity™
 
Resource Report
Resource Website
Miltenyi Biotec Cat# 130-100-871, RRID:AB_2656404 CD222 human clone REA187 Applications: MACS Flow Cytometry
Antigen Distribution: B cells, T cells, endothelial cells
monoclonal human AB_2656404 Miltenyi Biotec 130-100-871 2025-08-19 10:25:22 0
Anti-IP3 Receptor (MOUSE) Monoclonal Antibody - 200-301-F77
 
Resource Report
Resource Website
Rockland Cat# 200-301-F77, RRID:AB_2611182 IP3 Receptor Antibody rat S24-18 Immunohistochemistry,IF Microscopy,Western Blot, Anti-IP3 Antibody is suitable for use in WB, IP, and IHC monoclonal mouse AB_2611182 Rockland 200-301-F77 2025-08-19 10:25:20 0
EHMT2; Euchromatic histone-lysine N-methyltransferase 2 antibody - Protein Capture Reagents Program, produced by JHU/CDI; Protein Capture Reagents Program, produced by JHU/CDI
 
Resource Report
Resource Website
DSHB Cat# PCRP-EHMT2-3D9, RRID:AB_2618588 EHMT2; Euchromatic histone-lysine N-methyltransferase 2 human Application(s): Immunoprecipitation,Microarray; Date Deposited: 07/08/2015 monoclonal mouse AB_2618588 DSHB PCRP-EHMT2-3D9 2025-08-19 10:25:21 0
Anti-PHACTR2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA031725, RRID:AB_10610279 PHACTR2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10610279 Atlas Antibodies HPA031725 2025-08-19 10:25:23 0
Mouse Anti-Human WAVE1/SCAR Monoclonal IgG1
 
Resource Report
Resource Website
Discontinued
StressMarq Biosciences Cat# SMC-381S, RRID:AB_2571359 Synthetic peptide amino acids 477-498 of human Wave1/Wasp family1 human K91/36 Discontinued; Dilution:WB (1:1000), IHC (1:1000), ICC/IF (1:100); optimal dilutions for assays should be determined by the user.; Purification: Protein G Purified; Specificity: Detects ~75kDa.; This clone was listed and recorded at the vendor as S91-36. However this has now been confirmed to be K91/36 by the originator of the clone. monoclonal mouse AB_2571359 StressMarq Biosciences SMC-381S 2025-08-19 10:25:20 0
Progesterone Receptor Monoclonal Antibody (KMC912), Biotin, eBioscience
 
Resource Report
Resource Website
Discontinued
Thermo Fisher Scientific Cat# 13-9764-80, RRID:AB_2572830 Progesterone Receptor human KMC912 Discontinued: 2017; Original Manufacturer eBioscience, now part of Thermo Fisher; Applications: IF (Assay-Dependent), IHC (P) (2.5 ug/mL), ICC (Assay-Dependent); Reactive Species: Human monoclonal mouse AB_2572830 Thermo Fisher Scientific 13-9764-80 (also 13-9764) 2025-08-19 10:25:20 0
Psc-dmelanogaster
 
Resource Report
Resource Website
Rating or validation data
Vincenzo Pirrotta Cat# non-commercial Psc modENCODE antibody 1, RRID:AB_2616533 Psc drosophila melanogaster ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization unknown rabbit AB_2616533 Vincenzo Pirrotta non-commercial Psc modENCODE antibody 1 (also ENCAB163ZJM) 2025-08-19 10:25:21 0
Anti-TMEM170B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA055134, RRID:AB_2682709 TMEM170B human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2682709 Atlas Antibodies HPA055134 2025-08-19 10:25:26 0
OR13C4 Antibody
 
Resource Report
Resource Website
Discontinued
Thermo Fisher Scientific Cat# PA5-25703, RRID:AB_2543203 OR13C4 human Discontinued; Applications: Western Blot (1:100-500); Reactive Species: Human polyclonal rabbit AB_2543203 Thermo Fisher Scientific PA5-25703 2025-08-19 10:25:19 0
Anti-SOX9 (C-terminal) polyclonal antibody
 
Resource Report
Resource Website
Creative Diagnostics Cat# DPABH-25892, RRID:AB_2518972 SOX9 human WB unknown rabbit AB_2518972 Creative Diagnostics DPABH-25892 2025-08-19 10:25:24 0
Anti-C16ORF78 (aa 71-120) polyclonal antibody
 
Resource Report
Resource Website
Creative Diagnostics Cat# DPABH-13040, RRID:AB_2524780 C16ORF78 human WB unknown rabbit AB_2524780 Creative Diagnostics DPABH-13040 2025-08-19 10:25:24 0
Anti-RUVBL2 (aa 413-463) polyclonal antibody
 
Resource Report
Resource Website
Creative Diagnostics Cat# DPABH-19154, RRID:AB_2514997 RUVBL2 human IP unknown rabbit AB_2514997 Creative Diagnostics DPABH-19154 2025-08-19 10:25:16 0
Anti-PIAS3 polyclonal antibody
 
Resource Report
Resource Website
Creative Diagnostics Cat# DPABH-21353, RRID:AB_2516405 PIAS3 human WB unknown rabbit AB_2516405 Creative Diagnostics DPABH-21353 2025-08-19 10:25:17 0
Anti-CCDC146
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA020105, RRID:AB_2072056 CCDC146 human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2072056 Atlas Antibodies HPA020105 2025-08-19 10:25:23 0
Mouse Anti-Human TNK1 Monoclonal Antibody, MAAG4712
 
Resource Report
Resource Website
Discontinued
Creative Biomart Cat# CAB-6905MH, RRID:AB_10954774 Mouse Human TNK1 MAAG4712 mouse, human Discontinued: 2015; Discontinued on 27 July 2015; manufacturer recommendations: Western Blot,E; Western Blot monoclonal mouse AB_10954774 Creative Biomart CAB-6905MH 2025-08-19 10:25:26 0
Anti-KIF2C polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA006219, RRID:AB_2667540 KIF2C human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RYADRVKELSPHSGPSGEQLIQMETEEMEACSNGALIPGNLSKEEEELSSQMSSFNEAMTQIRELEEKAMEELKEIIQQGPDWLELSEMTEQPDYDLETFVNKAESALAQQAKHFSALR; Manufacturer approved use: ICC-IF polyclonal rabbit AB_2667540 Atlas Antibodies HPA006219 2025-08-19 10:25:23 0
Anti-NKIRAS2 (aa 129-191) polyclonal antibody
 
Resource Report
Resource Website
Creative Diagnostics Cat# DPABH-04046, RRID:AB_2520606 NKIRAS2 human WB, ICC/IF unknown rabbit AB_2520606 Creative Diagnostics DPABH-04046 2025-08-19 10:25:24 0
Anti-TNFRSF21 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA006746, RRID:AB_1078701 TNFRSF21 human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1078701 Atlas Antibodies HPA006746 2025-08-19 10:25:23 0
Mouse Anti-Clostridium tetani toxoid Monoclonal Antibody, Unconjugated, Clone 14F5
 
Resource Report
Resource Website
Cell Sciences Cat# CSI17228, RRID:AB_1157092 Clostridium tetani toxoid Clone 14F5 functionality unknown, check validation data for this product with vendor monoclonal mouse AB_1157092 Cell Sciences CSI17228 2025-08-19 10:25:27 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.