Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858649
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): UQCRC2
Proper citation: Atlas Antibodies Cat# HPA019146, RRID:AB_1858649 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856059
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): IPO7
Proper citation: Atlas Antibodies Cat# HPA019002, RRID:AB_1856059 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1859228
Comments: Rabbit polyclonal affinity purified generated using the immunogen: Zinc finger protein 384 recombinant protein epitope signature tag (PrEST)
Validation: ENCODE PROJECT validation information available
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF384
Proper citation: Sigma-Aldrich Cat# HPA004051, RRID:AB_1859228 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855502
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human PNMA1
Proper citation: Sigma-Aldrich Cat# HPA015007, RRID:AB_1855502 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849465
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human GANC
Proper citation: Sigma-Aldrich Cat# HPA016949, RRID:AB_1849465 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681891
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SERPINB13
Proper citation: Atlas Antibodies Cat# HPA052630, RRID:AB_2681891 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681753
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): WBSCR22
Proper citation: Atlas Antibodies Cat# HPA052185, RRID:AB_2681753 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616040
Comments: ENCODE PROJECT External validation DATA SET is released testing lot unknown for not specified; status is not eligible for new data
Host Organism: rabbit
Clonality: unknown
Target(s): lin-35
Proper citation: Covance Cat# Covance 030, RRID:AB_2616040 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682999
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAM160A2
Proper citation: Atlas Antibodies Cat# HPA055994, RRID:AB_2682999 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10697243
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): ARFIP2
Proper citation: Atlas Antibodies Cat# HPA038156, RRID:AB_10697243 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681994
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): CR2
Proper citation: Atlas Antibodies Cat# HPA052942, RRID:AB_2681994 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682624
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): NCSTN
Proper citation: Atlas Antibodies Cat# HPA054846, RRID:AB_2682624 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680898
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): REM1
Proper citation: Atlas Antibodies Cat# HPA049821, RRID:AB_2680898 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_938386
Comments: ENCODE PROJECT External validation DATA SET is released testing lot QC9683 for not specified; status is not pursued; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_2615138, AB_938386.
Host Organism: rabbit
Clonality: unknown
Target(s): SRSF8
Proper citation: Aviva Systems Biology Cat# ARP40526_T100, RRID:AB_938386 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795632
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CRYL1
Proper citation: Atlas Antibodies Cat# HPA040403, RRID:AB_10795632 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682321
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF555
Proper citation: Atlas Antibodies Cat# HPA053956, RRID:AB_2682321 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683894
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): BEX5
Proper citation: Atlas Antibodies Cat# HPA059058, RRID:AB_2683894 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686059
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PLSCR1
Proper citation: Atlas Antibodies Cat# HPA068923, RRID:AB_2686059 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_999694
Comments: Applications: WB, IP
Original Manufacturer
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF295
Proper citation: Bethyl Cat# A301-529A, RRID:AB_999694 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686365
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RSCLASQDPYCGWHSSRGCVDIRGSGGTDVDQAGNQESMEHGDCQDGATGSQSGPGDSAYVLPGPGPSPGTPSPPSDAHPRPQSSTL; Manufacturer approved use: ICC-IF, WB
Host Organism: rabbit
Clonality: polyclonal
Target(s): SEMA6C
Proper citation: Atlas Antibodies Cat# HPA071220, RRID:AB_2686365 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.