Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-KCNJ8 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA031066, RRID:AB_10602240 KCNJ8 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10602240 Atlas Antibodies HPA031066 2025-08-19 04:02:43 0
Anti-ZBP1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041256, RRID:AB_2677380 ZBP1 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2677380 Atlas Antibodies HPA041256 2025-08-19 04:02:45 0
Anti-ZNF500 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA057963, RRID:AB_2683565 ZNF500 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683565 Atlas Antibodies HPA057963 2025-08-19 04:02:44 0
Anti-ZCWPW2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA039839, RRID:AB_2676708 ZCWPW2 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2676708 Atlas Antibodies HPA039839 2025-08-19 04:02:45 0
Anti-RUFY1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA038804, RRID:AB_10673290 RUFY1 rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10673290 Atlas Antibodies HPA038804 2025-08-19 04:02:44 0
Anti-USB1
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041791, RRID:AB_10793933 USB1 human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10793933 Atlas Antibodies HPA041791 2025-08-19 04:02:43 0
Anti-VAMP5 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035082, RRID:AB_10610564 VAMP5 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10610564 Atlas Antibodies HPA035082 2025-08-19 04:02:44 0
Anti-RAB11FIP4 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA063203, RRID:AB_2684962 RAB11FIP4 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence DGFLRVERVAALGLRFGQGEEVEKLVKYLDPNDLGRINFKDFCRGVFAMKGCEELLKD; Manufacturer approved use: ICC-IF polyclonal rabbit AB_2684962 Atlas Antibodies HPA063203 2025-08-19 04:02:44 0
FITC anti-human CD4
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
BioLegend Cat# 344604, RRID:AB_1937227 CD4 human Clone SK3 Applications: FC monoclonal mouse AB_1937227 BioLegend 344604 2025-08-19 04:03:06 9
Human Angiopoietin-2 Antibody
 
Resource Report
Resource Website
Rating or validation data
R and D Systems Cat# MAB0983, RRID:AB_2258212 Angiopoietin-2 Human 180102 Applications: Western Blot monoclonal Mouse AB_2258212 R and D Systems MAB0983 (also MAB0983-100, MAB0983-500, MAB0983-SP) 2025-08-19 04:03:16 0
HPi1 Antibody (HIC0-4F9) [Biotin]
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Novus Cat# NBP1-18872B, RRID:AB_2126328 HPi1 Human, Mouse HIC0-4F9 Applications: Flow Cytometry, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Frozen monoclonal Mouse AB_2126328 Novus NBP1-18872B 2025-08-19 04:03:06 1
Anti-SFXN4 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA018028, RRID:AB_1856792 Human SFXN4 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1856792 Sigma-Aldrich HPA018028 2025-08-19 04:03:39 0
Anti-BAIAP2 antibody produced in rabbit
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Sigma-Aldrich Cat# HPA023310, RRID:AB_1845264 Human BAIAP2 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1845264 Sigma-Aldrich HPA023310 2025-08-19 04:03:26 2
Tyrosinase-Related Protein-1
 
Resource Report
Resource Website
Rating or validation data
Covance Cat# SIG-38150-1000, RRID:AB_663161 SK-MEL23 Melanomacell line Used By NYUIHC-562
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:TRUE, Functional in animal:FALSE, NonFunctional in animal:FALSE
monoclonal AB_663161 Covance SIG-38150-1000 2025-08-19 04:03:35 0
Anti-ARSB antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA037771, RRID:AB_10671720 ARSB antibody produced in rabbit human Vendor recommendations: Other; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_10671720 Sigma-Aldrich HPA037771 2025-08-19 04:03:42 0
Anti-MBL2 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA002027, RRID:AB_1079324 MBL2 antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Immunohistochemistry; Other; Western Blot polyclonal rabbit AB_1079324 Sigma-Aldrich HPA002027 2025-08-19 03:58:20 0
Rabbit anti-ZC3H11A Antibody, Affinity Purified
 
Resource Report
Resource Website
Discontinued
Rating or validation data
Bethyl Cat# A301-524A, RRID:AB_999686 ZC3H11A human Applications: WB, IP, IHC
Original Manufacturer
polyclonal rabbit AB_999686 Bethyl A301-524A (also A301-524A-M, A301-524A-T) 2025-08-19 03:58:26 0
Anti-RAB43 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA060085, RRID:AB_2684199 RAB43 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2684199 Atlas Antibodies HPA060085 2025-08-19 03:58:23 0
Anti-POU4F3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA038215, RRID:AB_10697245 POU4F3 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10697245 Atlas Antibodies HPA038215 2025-08-19 03:58:51 0
E(bx)-dmelanogaster
 
Resource Report
Resource Website
Rating or validation data
SDIX Cat# sdix E(bx) modENCODE antibody 2, RRID:AB_2616356 E(bx) drosophila melanogaster ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization unknown rabbit AB_2616356 SDIX sdix E(bx) modENCODE antibody 2 (also ENCAB193GJL) 2025-08-19 03:58:48 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.