Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Anti-KCNJ8 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA031066, RRID:AB_10602240 | KCNJ8 | human | Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10602240 | Atlas Antibodies | HPA031066 | 2025-08-19 04:02:43 | 0 | ||
|
Anti-ZBP1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA041256, RRID:AB_2677380 | ZBP1 | human | Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2677380 | Atlas Antibodies | HPA041256 | 2025-08-19 04:02:45 | 0 | ||
|
Anti-ZNF500 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA057963, RRID:AB_2683565 | ZNF500 | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2683565 | Atlas Antibodies | HPA057963 | 2025-08-19 04:02:44 | 0 | ||
|
Anti-ZCWPW2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA039839, RRID:AB_2676708 | ZCWPW2 | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2676708 | Atlas Antibodies | HPA039839 | 2025-08-19 04:02:45 | 0 | ||
|
Anti-RUFY1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA038804, RRID:AB_10673290 | RUFY1 | rat, mouse, human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10673290 | Atlas Antibodies | HPA038804 | 2025-08-19 04:02:44 | 0 | ||
|
Anti-USB1 Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA041791, RRID:AB_10793933 | USB1 | human | Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_10793933 | Atlas Antibodies | HPA041791 | 2025-08-19 04:02:43 | 0 | ||
|
Anti-VAMP5 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA035082, RRID:AB_10610564 | VAMP5 | human | Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10610564 | Atlas Antibodies | HPA035082 | 2025-08-19 04:02:44 | 0 | ||
|
Anti-RAB11FIP4 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA063203, RRID:AB_2684962 | RAB11FIP4 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence DGFLRVERVAALGLRFGQGEEVEKLVKYLDPNDLGRINFKDFCRGVFAMKGCEELLKD; Manufacturer approved use: ICC-IF | polyclonal | rabbit | AB_2684962 | Atlas Antibodies | HPA063203 | 2025-08-19 04:02:44 | 0 | ||
|
FITC anti-human CD4 Resource Report Resource Website 1+ mentions Rating or validation data |
BioLegend Cat# 344604, RRID:AB_1937227 | CD4 | human | Clone SK3 | Applications: FC | monoclonal | mouse | AB_1937227 | BioLegend | 344604 | 2025-08-19 04:03:06 | 9 | |
|
Human Angiopoietin-2 Antibody Resource Report Resource Website Rating or validation data |
R and D Systems Cat# MAB0983, RRID:AB_2258212 | Angiopoietin-2 | Human | 180102 | Applications: Western Blot | monoclonal | Mouse | AB_2258212 | R and D Systems | MAB0983 (also MAB0983-100, MAB0983-500, MAB0983-SP) | 2025-08-19 04:03:16 | 0 | |
|
HPi1 Antibody (HIC0-4F9) [Biotin] Resource Report Resource Website 1+ mentions Rating or validation data |
Novus Cat# NBP1-18872B, RRID:AB_2126328 | HPi1 | Human, Mouse | HIC0-4F9 | Applications: Flow Cytometry, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Frozen | monoclonal | Mouse | AB_2126328 | Novus | NBP1-18872B | 2025-08-19 04:03:06 | 1 | |
|
Anti-SFXN4 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA018028, RRID:AB_1856792 | Human SFXN4 | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1856792 | Sigma-Aldrich | HPA018028 | 2025-08-19 04:03:39 | 0 | ||
|
Anti-BAIAP2 antibody produced in rabbit Resource Report Resource Website 1+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA023310, RRID:AB_1845264 | Human BAIAP2 | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1845264 | Sigma-Aldrich | HPA023310 | 2025-08-19 04:03:26 | 2 | ||
|
Tyrosinase-Related Protein-1 Resource Report Resource Website Rating or validation data |
Covance Cat# SIG-38150-1000, RRID:AB_663161 | SK-MEL23 Melanomacell line |
Used By NYUIHC-562 Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:TRUE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
monoclonal | AB_663161 | Covance | SIG-38150-1000 | 2025-08-19 04:03:35 | 0 | ||||
|
Anti-ARSB antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA037771, RRID:AB_10671720 | ARSB antibody produced in rabbit | human | Vendor recommendations: Other; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable | polyclonal | rabbit | AB_10671720 | Sigma-Aldrich | HPA037771 | 2025-08-19 04:03:42 | 0 | ||
|
Anti-MBL2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA002027, RRID:AB_1079324 | MBL2 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Immunohistochemistry; Other; Western Blot | polyclonal | rabbit | AB_1079324 | Sigma-Aldrich | HPA002027 | 2025-08-19 03:58:20 | 0 | ||
|
Rabbit anti-ZC3H11A Antibody, Affinity Purified Resource Report Resource Website Discontinued Rating or validation data |
Bethyl Cat# A301-524A, RRID:AB_999686 | ZC3H11A | human |
Applications: WB, IP, IHC Original Manufacturer |
polyclonal | rabbit | AB_999686 | Bethyl | A301-524A (also A301-524A-M, A301-524A-T) | 2025-08-19 03:58:26 | 0 | ||
|
Anti-RAB43 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA060085, RRID:AB_2684199 | RAB43 | human | Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2684199 | Atlas Antibodies | HPA060085 | 2025-08-19 03:58:23 | 0 | ||
|
Anti-POU4F3 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA038215, RRID:AB_10697245 | POU4F3 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10697245 | Atlas Antibodies | HPA038215 | 2025-08-19 03:58:51 | 0 | ||
|
E(bx)-dmelanogaster Resource Report Resource Website Rating or validation data |
SDIX Cat# sdix E(bx) modENCODE antibody 2, RRID:AB_2616356 | E(bx) | drosophila melanogaster | ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization | unknown | rabbit | AB_2616356 | SDIX | sdix E(bx) modENCODE antibody 2 (also ENCAB193GJL) | 2025-08-19 03:58:48 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.