Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858405
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TSPAN2
Proper citation: Atlas Antibodies Cat# HPA015640, RRID:AB_1858405 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2243752
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): C6orf15
Proper citation: Sigma-Aldrich Cat# HPA001436, RRID:AB_2243752 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1903955
Comments: Applications: W, IP, IHC-P, IF-P, IF-IC, F
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality: monoclonal
Target(s): EGFR (L858R Mutant Specific) (43B2) Rabbit mAb detects endogenous levels of EGFR mutant L858R protein. Careful titration of this antibody may be required to obtain optimal specificity.
Proper citation: Cell Signaling Technology Cat# 3197, RRID:AB_1903955 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2335901
Comments: Used By NYUIHC-149
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality: monoclonal
Target(s): Human P-Cadherin aa. 72-259
Proper citation: BD Biosciences Cat# C24120, RRID:AB_2335901 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680650
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CCND2
Proper citation: Atlas Antibodies Cat# HPA049138, RRID:AB_2680650 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680427
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TMEM55B
Proper citation: Atlas Antibodies Cat# HPA048528, RRID:AB_2680427 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2677666
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CARS2
Proper citation: Atlas Antibodies Cat# HPA041776, RRID:AB_2677666 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684507
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): VWA5B2
Proper citation: Atlas Antibodies Cat# HPA061412, RRID:AB_2684507 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601593
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SRP72
Proper citation: Atlas Antibodies Cat# HPA034621, RRID:AB_10601593 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2677978
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTW; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): IL22RA1
Proper citation: Atlas Antibodies Cat# HPA042399, RRID:AB_2677978 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674403
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): PRKRA
Proper citation: Atlas Antibodies Cat# HPA034997, RRID:AB_2674403 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686549
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KIAA0319L
Proper citation: Atlas Antibodies Cat# HPA072692, RRID:AB_2686549 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674092
Host Organism: rabbit
Clonality: unknown
Target(s): TSPYL1
Proper citation: Sigma-Aldrich Cat# HPA031970, RRID:AB_2674092 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2678022
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): AGAP4
Proper citation: Atlas Antibodies Cat# HPA042490, RRID:AB_2678022 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686099
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GTF3C3
Proper citation: Atlas Antibodies Cat# HPA069179, RRID:AB_2686099 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2666241
Host Organism: rabbit
Clonality: unknown
Target(s): CKAP4
Proper citation: Sigma-Aldrich Cat# HPA001225, RRID:AB_2666241 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600814
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASLNHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNLLSLHTAS; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): SPHK1
Proper citation: Atlas Antibodies Cat# HPA028761, RRID:AB_10600814 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680070
Host Organism: rabbit
Clonality: unknown
Target(s): RPL32
Proper citation: Sigma-Aldrich Cat# HPA047501, RRID:AB_2680070 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2676960
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CPEB1
Proper citation: Atlas Antibodies Cat# HPA040396, RRID:AB_2676960 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686007
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): BCORL1
Proper citation: Atlas Antibodies Cat# HPA068568, RRID:AB_2686007 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.