Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-FN1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA027066, RRID:AB_10602500 FN1 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10602500 Atlas Antibodies HPA027066 2025-08-19 04:38:16 0
Anti-TCEAL8 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA059115, RRID:AB_2683909 TCEAL8 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683909 Atlas Antibodies HPA059115 2025-08-19 04:37:44 0
Anti-CYB5R2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA038962, RRID:AB_10675954 CYB5R2 human Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10675954 Atlas Antibodies HPA038962 2025-08-19 04:37:43 0
Anti-PRR11 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA052376, RRID:AB_2681803 PRR11 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681803 Atlas Antibodies HPA052376 2025-08-19 04:37:44 0
Anti-PCNA
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA030522, RRID:AB_10602096 PCNA rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10602096 Atlas Antibodies HPA030522 2025-08-19 04:37:43 0
Anti-FAH
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA041370, RRID:AB_2677438 FAH human unknown rabbit AB_2677438 Sigma-Aldrich HPA041370 2025-08-19 04:37:45 0
p16 INK4a
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
BD Biosciences Cat# 551153, RRID:AB_394077 Full length recombinant bacterialy produced p16 tag-fusion protein human [G175-405] Applications: Western blot, Immunohistochemistry-frozen, Immunohistochemistry-paraffin, Immunoprecipitation
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
monoclonal mouse AB_394077 BD Biosciences 551153 2025-08-19 04:38:09 1
Anti-RPH3AL polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA024311, RRID:AB_1856429 RPH3AL human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1856429 Atlas Antibodies HPA024311 2025-08-19 04:38:14 0
Anti-SLC6A17 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA008044, RRID:AB_1857192 SLC6A17 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1857192 Atlas Antibodies HPA008044 2025-08-19 04:38:14 0
Anti-OTOF polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA007502, RRID:AB_1079536 OTOF human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence WWSKYFASIDTMKEQLRQQEPSGIDLEEKEEVDNTEGLKGSMKGKEKARAAKEEKKKKTQSSGSGQGSEAPEKKKPKIDELKVYPKELESEFDNFEDWLHTFNLLRGKTGDDE; Manufacturer approved use: IHC polyclonal rabbit AB_1079536 Atlas Antibodies HPA007502 2025-08-19 04:50:20 0
Anti-FAM198B
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA007227, RRID:AB_1847689 FAM198B human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1847689 Atlas Antibodies HPA007227 2025-08-19 04:50:20 0
Anti-WNK2
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA016519, RRID:AB_2669380 WNK2 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2669380 Atlas Antibodies HPA016519 2025-08-19 04:50:21 0
Anti-FAM161B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA019125, RRID:AB_1845570 FAM161B human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1845570 Atlas Antibodies HPA019125 2025-08-19 04:50:21 0
Anti-GARS
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA017896, RRID:AB_1849478 GARS human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1849478 Atlas Antibodies HPA017896 2025-08-19 04:50:21 0
Anti-FBN2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA012853, RRID:AB_1848588 FBN2 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1848588 Atlas Antibodies HPA012853 2025-08-19 04:50:21 0
Anti-MPDZ polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA020255, RRID:AB_1854073 MPDZ human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1854073 Atlas Antibodies HPA020255 2025-08-19 04:50:25 0
LARP4-human
 
Resource Report
Resource Website
1+ mentions
Discontinued
Rating or validation data
Thermo Fisher Scientific Cat# A303-900A, RRID:AB_2620250 LARP4 mouse, human Discontinued; Applications: WB (1:1,000-1:5,000), IP (2-10 µg/mg lysate) polyclonal rabbit AB_2620250 Thermo Fisher Scientific A303-900A 2025-08-19 04:50:26 1
STAT6-human
 
Resource Report
Resource Website
Rating or validation data
Santa Cruz Biotechnology Cat# sc-1689, RRID:AB_628296 STAT6 Homo sapiens C-9 ENCODE PROJECT External validation DATA SET is released testing lot B2212 for not specified; status is not pursued monoclonal mouse AB_628296 Santa Cruz Biotechnology sc-1689 2025-08-19 04:50:58 0
Anti-MRPL3 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA043665, RRID:AB_2678606 MRPL3 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2678606 Atlas Antibodies HPA043665 2025-08-19 04:45:10 1
Anti-SYNE3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA055227, RRID:AB_2682747 SYNE3 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2682747 Atlas Antibodies HPA055227 2025-08-19 04:45:11 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.