Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-NPB polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA057419, RRID:AB_2683433 NPB human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SQPYRGAEPPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANVFLSLR; Manufacturer approved use: IHC polyclonal rabbit AB_2683433 Atlas Antibodies HPA057419 2025-08-19 05:08:17 0
Anti-HEY2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA074851, RRID:AB_2686718 HEY2 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2686718 Atlas Antibodies HPA074851 2025-08-19 05:08:17 0
Anti-C16orf72 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA067492, RRID:AB_2685850 C16orf72 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2685850 Atlas Antibodies HPA067492 2025-08-19 05:07:39 0
Anti-PRR16 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA049254, RRID:AB_2680693 PRR16 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680693 Atlas Antibodies HPA049254 2025-08-19 05:07:38 0
Anti-TTF2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA005776, RRID:AB_1080416 TTF2 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1080416 Atlas Antibodies HPA005776 2025-08-19 05:08:17 0
Anti-ALG5 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA007989, RRID:AB_1078132 Human ALG5 human Vendor recommendations: unknown rabbit AB_1078132 Sigma-Aldrich HPA007989 2025-08-19 04:53:49 0
Anti-PDCD2L antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA019964, RRID:AB_1855105 PDCD2L human polyclonal rabbit AB_1855105 Atlas Antibodies HPA019964 2025-08-19 04:53:52 0
Anti-RNASE2 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA044983, RRID:AB_10963689 RNASE2 antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable polyclonal AB_10963689 Sigma-Aldrich HPA044983 2025-08-19 04:53:48 0
CXCL10 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Abnova Cat# PAB19527, RRID:AB_10902053 CXCL10 polyclonal antibody human manufacturer recommendations: WB-Re,IHC-P; Western Blot; Immunohistochemistry - fixed; Immunohistochemistry polyclonal rabbit AB_10902053 Abnova PAB19527 2025-08-19 04:54:01 0
DPF2-human
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# WH0005977M1, RRID:AB_1841346 DPF2 homo sapiens Clone 2F6 ENCODE PROJECT External validation DATA SET is released testing lot 11088-2F6 for not specified; status is not pursued monoclonal mouse AB_1841346 Sigma-Aldrich WH0005977M1 2025-08-19 04:54:02 0
Anti-ZNF295 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA024655, RRID:AB_1859171 Human ZNF295 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1859171 Sigma-Aldrich HPA024655 2025-08-19 04:54:06 0
Anti-TIGD6 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA044599, RRID:AB_10961286 TIGD6 antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal AB_10961286 Sigma-Aldrich HPA044599 2025-08-19 04:54:04 0
Anti-C9orf71 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA045272, RRID:AB_10961185 C9orf71 antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal AB_10961185 Sigma-Aldrich HPA045272 2025-08-19 04:54:16 0
Anti-DDAH1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA006308, RRID:AB_1847532 DDAH1 antibody produced in rabbit human Vendor recommendations: Immunofluorescence; Immunohistochemistry; Other; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_1847532 Sigma-Aldrich HPA006308 2025-08-19 04:54:17 0
Anti-AL590708.2 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA014540, RRID:AB_10796110 AL590708.2 antibody produced in rabbit human polyclonal rabbit AB_10796110 Atlas Antibodies HPA014540 2025-08-19 04:54:22 0
Anti-SNRK antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA042163, RRID:AB_10794645 SNRK antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry polyclonal rabbit AB_10794645 Sigma-Aldrich HPA042163 2025-08-19 05:11:10 0
Anti-TMEM151A antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA041035, RRID:AB_10794404 TMEM151A antibody produced in rabbit human Vendor recommendations: Other; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_10794404 Sigma-Aldrich HPA041035 2025-08-19 05:10:42 0
Anti-SH3GLB1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA015608, RRID:AB_1845355 SH3GLB1 rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1845355 Atlas Antibodies HPA015608 2025-08-19 05:10:42 0
Anti-LRRC24 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA052250, RRID:AB_2681774 LRRC24 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681774 Atlas Antibodies HPA052250 2025-08-19 05:11:10 0
ENCODE Project Antibody validation c-Myc
 
Resource Report
Resource Website
10+ mentions
Discontinued
Rating or validation data
Santa Cruz Biotechnology Cat# sc-764, RRID:AB_631276 MYC human Discontinued: 2016; Discontinued: 2016; Rabbit polyclonal affinity purified to amino acids 1-262 of c-Myc human origin. Antibody Target: MYC
Validation: ENCODE PROJECT validation information available
polyclonal rabbit AB_631276 Santa Cruz Biotechnology sc-764 2025-08-19 05:10:42 39

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.