Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683433
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SQPYRGAEPPGGAGASPELQLHPRLRSLAVCVQDVAPNLQRCERLPDGRGTYQCKANVFLSLR; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): NPB
Proper citation: Atlas Antibodies Cat# HPA057419, RRID:AB_2683433 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686718
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): HEY2
Proper citation: Atlas Antibodies Cat# HPA074851, RRID:AB_2686718 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685850
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): C16orf72
Proper citation: Atlas Antibodies Cat# HPA067492, RRID:AB_2685850 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680693
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PRR16
Proper citation: Atlas Antibodies Cat# HPA049254, RRID:AB_2680693 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080416
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TTF2
Proper citation: Atlas Antibodies Cat# HPA005776, RRID:AB_1080416 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078132
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality: unknown
Target(s): Human ALG5
Proper citation: Sigma-Aldrich Cat# HPA007989, RRID:AB_1078132 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855105
Host Organism: rabbit
Clonality: polyclonal
Target(s): PDCD2L
Proper citation: Atlas Antibodies Cat# HPA019964, RRID:AB_1855105 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10963689
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable
Clonality: polyclonal
Target(s): RNASE2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA044983, RRID:AB_10963689 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10902053
Comments: manufacturer recommendations: WB-Re,IHC-P; Western Blot; Immunohistochemistry - fixed; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): CXCL10 polyclonal antibody
Proper citation: Abnova Cat# PAB19527, RRID:AB_10902053 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1841346
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 11088-2F6 for not specified; status is not pursued
Host Organism: mouse
Clonality: monoclonal
Target(s): DPF2
Proper citation: Sigma-Aldrich Cat# WH0005977M1, RRID:AB_1841346 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1859171
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human ZNF295
Proper citation: Sigma-Aldrich Cat# HPA024655, RRID:AB_1859171 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10961286
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Clonality: polyclonal
Target(s): TIGD6 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA044599, RRID:AB_10961286 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10961185
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Clonality: polyclonal
Target(s): C9orf71 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA045272, RRID:AB_10961185 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847532
Comments: Vendor recommendations: Immunofluorescence; Immunohistochemistry; Other; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): DDAH1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA006308, RRID:AB_1847532 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10796110
Host Organism: rabbit
Clonality: polyclonal
Target(s): AL590708.2 antibody produced in rabbit
Proper citation: Atlas Antibodies Cat# HPA014540, RRID:AB_10796110 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794645
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): SNRK antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA042163, RRID:AB_10794645 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794404
Comments: Vendor recommendations: Other; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): TMEM151A antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA041035, RRID:AB_10794404 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845355
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SH3GLB1
Proper citation: Atlas Antibodies Cat# HPA015608, RRID:AB_1845355 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681774
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): LRRC24
Proper citation: Atlas Antibodies Cat# HPA052250, RRID:AB_2681774 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_631276
Comments: Discontinued: 2016; Discontinued: 2016; Rabbit polyclonal affinity purified to amino acids 1-262 of c-Myc human origin. Antibody Target: MYC
Validation: ENCODE PROJECT validation information available
Host Organism: rabbit
Clonality: polyclonal
Target(s): MYC
Proper citation: Santa Cruz Biotechnology Cat# sc-764, RRID:AB_631276 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.