Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 306 showing 6101 ~ 6120 out of 55,392 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2675023

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RLVITNGMVIPNYSSRTEYEKLFALGVTMYGQMTAGSYCYIGPQGIVHGTVLTVLNAARRYLGIEDLAGKVFVTSGLGGMSGAQAKAAVIVGCIG; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): UROC1

Proper citation: Atlas Antibodies Cat# HPA036254, RRID:AB_2675023 Copy   


  • RRID:AB_2732677

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2732677

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): RC3H2

Proper citation: Atlas Antibodies Cat# HPA062144, RRID:AB_2732677 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10796238

Host Organism: rabbit
Clonality: polyclonal
Target(s): ANGPTL6 antibody produced in rabbit

Proper citation: Atlas Antibodies Cat# HPA041171, RRID:AB_10796238 Copy   


  • RRID:AB_10001196

    This resource has 10+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10001196

Comments: Applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
Host Organism: Rabbit
Clonality: polyclonal
Target(s): GAP-43

Proper citation: Novus Cat# NB300-143, RRID:AB_10001196 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1859459

Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF804B antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA026702, RRID:AB_1859459 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1847587

Comments: Vendor recommendations: Western Blot; Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): DECR1 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA023238, RRID:AB_1847587 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10671841

Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAM53A antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA036452, RRID:AB_10671841 Copy   


Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_203285

Comments: Applications: WB, IP
Host Organism: rabbit
Clonality: polyclonal
Target(s): Diaphanous 1

Proper citation: Bethyl Cat# A300-077A, RRID:AB_203285 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1078606

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): CCNK antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA000645, RRID:AB_1078606 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1845191

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): ATP6V0D1 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA016938, RRID:AB_1845191 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1848782

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): TRMT61B antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA026747, RRID:AB_1848782 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1850498

Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): HAPLN1 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA019482, RRID:AB_1850498 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1078146

Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): AMN antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA000817, RRID:AB_1078146 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10602082

Comments: Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): PRKD3 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA029529, RRID:AB_10602082 Copy   


  • RRID:AB_10954105

Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10954105

Comments: Discontinued; Applications: IP (2-10 µg/mg lysate)
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF316

Proper citation: Thermo Fisher Scientific Cat# A303-249A, RRID:AB_10954105 Copy   


  • RRID:AB_2088298

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2088298

Comments: validation status unknown check with seller; recommendations: WB, IF, IHC(P); Immunohistochemistry; Western Blot; Immunocytochemistry; Immunofluorescence
Host Organism: mouse
Clonality: monoclonal
Target(s): SDF-1 (P-159X)

Proper citation: Santa Cruz Biotechnology Cat# sc-74271, RRID:AB_2088298 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10671865

Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): EYA4 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA038771, RRID:AB_10671865 Copy   


  • RRID:AB_2144271

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2144271

Comments: Applications: Western Blot, Immunohistochemistry, Immunoprecipitation, Neutralization, Knockout Validated
Host Organism: Mouse
Clonality: monoclonal
Target(s): MMP-1

Proper citation: R and D Systems Cat# MAB901, RRID:AB_2144271 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1844298

Comments: Vendor recommendations: IgG1kappa indirect ELISA: suitable, immunoblotting: suitable; Western Blot; ELISA
Host Organism: mouse
Clonality: monoclonal
Target(s): ZNF277 antibody produced in mouse

Proper citation: Sigma-Aldrich Cat# WH0011179M1, RRID:AB_1844298 Copy   


  • RRID:AB_310102

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_310102

Comments: ENCODE PROJECT External validation DATA SET is released testing lot unknown for not specified; status is not eligible for new data
Host Organism: sheep
Clonality: polyclonal
Target(s): ATF1

Proper citation: Millipore Cat# 06-325, RRID:AB_310102 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within dkNET that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X