Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-FBXL17 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA036410, RRID:AB_2675109 FBXL17 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2675109 Atlas Antibodies HPA036410 2025-08-19 05:18:56 0
ZNF385A-human
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA039799, RRID:AB_10795117 ZNF385A human polyclonal rabbit AB_10795117 Atlas Antibodies HPA039799 2025-08-19 05:19:06 0
Anti-ZNF620 Antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA059383, RRID:AB_2732636 ZNF620 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2732636 Atlas Antibodies HPA059383 2025-08-19 05:19:02 0
Anti-PARVA antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA005964, RRID:AB_1079569 PARVA antibody produced in rabbit human Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Western Blot; Immunofluorescence; Immunohistochemistry polyclonal rabbit AB_1079569 Sigma-Aldrich HPA005964 2025-08-19 05:19:06 0
Anti-NRIP3
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA040573, RRID:AB_10805713 NRIP3 human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10805713 Atlas Antibodies HPA040573 2025-08-19 05:37:43 0
Anti-KAT8 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA066324, RRID:AB_2685658 KAT8 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2685658 Atlas Antibodies HPA066324 2025-08-19 05:37:44 0
Anti-IL23A polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA001554, RRID:AB_1079135 IL23A human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRF; Manufacturer approved use: IHC, WB polyclonal rabbit AB_1079135 Atlas Antibodies HPA001554 2025-08-19 05:37:42 0
Anti-RPL21 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA047252, RRID:AB_2680000 RPL21 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680000 Atlas Antibodies HPA047252 2025-08-19 05:37:43 0
Anti-BEX2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA045384, RRID:AB_2679305 BEX2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2679305 Atlas Antibodies HPA045384 2025-08-19 05:37:43 0
Anti-NVL polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA028224, RRID:AB_2672529 NVL human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2672529 Atlas Antibodies HPA028224 2025-08-19 05:37:42 0
Anti-FBXL20 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA050397, RRID:AB_2681112 FBXL20 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681112 Atlas Antibodies HPA050397 2025-08-19 05:37:44 0
Anti-DPEP2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035644, RRID:AB_10670164 DPEP2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10670164 Atlas Antibodies HPA035644 2025-08-19 05:37:42 0
Anti-LLGL1 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA022924, RRID:AB_1852926 LLGL1 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1852926 Atlas Antibodies HPA022924 2025-08-19 05:38:09 1
Anti-PPP4R3A polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA063917, RRID:AB_2685153 PPP4R3A human Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2685153 Atlas Antibodies HPA063917 2025-08-19 05:38:10 0
Anti-NICN1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA058014, RRID:AB_2683579 NICN1 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683579 Atlas Antibodies HPA058014 2025-08-19 05:38:10 0
Anti-AMTN
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA036136, RRID:AB_2674963 AMTN human unknown rabbit AB_2674963 Sigma-Aldrich HPA036136 2025-08-19 05:38:12 0
Anti-ASB2 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA001546, RRID:AB_1078224 ASB2 human polyclonal rabbit AB_1078224 Atlas Antibodies HPA001546 2025-08-19 05:38:12 0
Anti-CDRT1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA013332, RRID:AB_1848471 CDRT1 human polyclonal rabbit AB_1848471 Atlas Antibodies HPA013332 2025-08-19 05:38:12 0
Anti-TADA1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA028651, RRID:AB_10602476 TADA1 antibody produced in rabbit human polyclonal rabbit AB_10602476 Atlas Antibodies HPA028651 2025-08-19 05:38:17 0
Anti-RAD54L2 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA035004, RRID:AB_10671930 RAD54L2 antibody produced in rabbit human polyclonal rabbit AB_10671930 Atlas Antibodies HPA035004 2025-08-19 05:38:29 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.