Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
SPDEF-human Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# WH0025803M1, RRID:AB_1843734 | SPDEF | homo sapiens | Clone 4A5 | ENCODE PROJECT External validation DATA SET is released testing lot 12027-4A5 for any cell type or tissues; status is awaiting lab characterization | monoclonal | mouse | AB_1843734 | Sigma-Aldrich | WH0025803M1 | 2025-08-19 05:18:06 | 0 | |
|
Anti-ALCAM antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA010926, RRID:AB_1078449 | CD166 | human | Rated by ISCC, Intestinal Stem Cell Consortium (check ratings https://iscc.coh.org/) | unknown | AB_1078449 | Sigma-Aldrich | HPA010926 | 2025-08-19 05:18:22 | 0 | |||
|
Rabbit Anti-SYNCRIP Polyclonal Antibody, Unconjugated Resource Report Resource Website Rating or validation data |
Aviva Systems Biology Cat# ARP40641_T100, RRID:AB_2271535 | SYNCRIP | other, rat, canine, mouse, fish, zebrafish, human, dog | manufacturer recommendations: ELISA; Western Blot; ELISA (titre 1:312500), Western Blot; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_2615120, AB_2271535. | polyclonal | rabbit | AB_2271535 | Aviva Systems Biology | ARP40641_T100 | 2025-08-19 05:18:25 | 0 | ||
|
Anti-CYP11B2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA057752, RRID:AB_2683516 | CYP11B2 | human | Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2683516 | Atlas Antibodies | HPA057752 | 2025-08-19 05:18:56 | 0 | ||
|
Anti-USP35 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA055213, RRID:AB_2682740 | USP35 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2682740 | Atlas Antibodies | HPA055213 | 2025-08-19 05:18:33 | 0 | ||
|
Anti-C14orf80 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA039050, RRID:AB_10670918 | C14orf80 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10670918 | Atlas Antibodies | HPA039050 | 2025-08-19 05:18:33 | 0 | ||
|
Anti-WFS1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA029128, RRID:AB_10603460 | WFS1 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10603460 | Atlas Antibodies | HPA029128 | 2025-08-19 05:18:33 | 0 | ||
|
Anti-OSBPL5 Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA058727, RRID:AB_2683799 | OSBPL5 | human | Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_2683799 | Atlas Antibodies | HPA058727 | 2025-08-19 05:18:34 | 0 | ||
|
Anti-SLC1A4 Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA034964, RRID:AB_2674386 | SLC1A4 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_2674386 | Atlas Antibodies | HPA034964 | 2025-08-19 05:18:55 | 0 | ||
|
Anti-SEC23B polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA069974, RRID:AB_2686223 | SEC23B | human | Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2686223 | Atlas Antibodies | HPA069974 | 2025-08-19 05:18:34 | 0 | ||
|
Anti-SLC28A3 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA024729, RRID:AB_1857069 | SLC28A3 | human | Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1857069 | Atlas Antibodies | HPA024729 | 2025-08-19 05:18:33 | 0 | ||
|
Anti-GLRA4 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA044759, RRID:AB_10795885 | GLRA4 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_10795885 | Atlas Antibodies | HPA044759 | 2025-08-19 05:18:33 | 0 | ||
|
Anti-PKD2L2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA041903, RRID:AB_2677734 | PKD2L2 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2677734 | Atlas Antibodies | HPA041903 | 2025-08-19 05:18:56 | 0 | ||
|
Anti-NICN1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA037550, RRID:AB_10672599 | NICN1 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VPCHVKGSVALQVGDVRTSQGRPGVLVIDVTFPSVAPFELQEITFKNYYTAFLSIRVRQYTSAHTP; Manufacturer approved use: IHC, WB | polyclonal | rabbit | AB_10672599 | Atlas Antibodies | HPA037550 | 2025-08-19 05:18:33 | 0 | ||
|
Anti-ELP6 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA064545, RRID:AB_2685282 | ELP6 | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2685282 | Atlas Antibodies | HPA064545 | 2025-08-19 05:18:56 | 0 | ||
|
Anti-HDGF Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA048728, RRID:AB_2680503 | HDGF | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_2680503 | Atlas Antibodies | HPA048728 | 2025-08-19 05:18:56 | 0 | ||
|
H3K4me2-celegans Resource Report Resource Website Rating or validation data |
Agilent Cat# 308-34809, RRID:AB_2616535 | H3K4me2 | caenorhabditis elegans | ENCODE PROJECT External validation DATA SET is released testing lot unknown for not specified; status is not eligible for new data | unknown | mouse | AB_2616535 | Agilent | 308-34809 (also ENCAB420YAH) | 2025-08-19 05:18:32 | 0 | ||
|
Anti-TRA2B polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA064972, RRID:AB_2685396 | TRA2B | human | Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2685396 | Atlas Antibodies | HPA064972 | 2025-08-19 05:18:56 | 0 | ||
|
Anti-ZNF277 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA027307, RRID:AB_1859164 | ZNF277 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1859164 | Atlas Antibodies | HPA027307 | 2025-08-19 05:18:55 | 0 | ||
|
Anti-SRL Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA041535, RRID:AB_2677538 | SRL | human | Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_2677538 | Atlas Antibodies | HPA041535 | 2025-08-19 05:18:56 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.