Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Norway

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Validation:information available (facet)

Facets

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Target Antigen

Sort Ascending

Sort Descending

 Target Organism

Sort Ascending

Sort Descending

 Clone ID
Defining Citation

Sort Ascending

Sort Descending

 Comments
Clonality

Sort Ascending

Sort Descending

 Host Organism

Sort Ascending

Sort Descending

 Antibody ID
Vendor

Sort Ascending

Sort Descending

 Catalog Number
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
SPDEF-human
 
Resource Report
Resource Website
Rating or validation data 		Sigma-Aldrich Cat# WH0025803M1, RRID:AB_1843734 SPDEF homo sapiens Clone 4A5 ENCODE PROJECT External validation DATA SET is released testing lot 12027-4A5 for any cell type or tissues; status is awaiting lab characterization monoclonal mouse AB_1843734 Sigma-Aldrich WH0025803M1 2025-08-19 05:18:06 0
Anti-ALCAM antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data 		Sigma-Aldrich Cat# HPA010926, RRID:AB_1078449 CD166 human Rated by ISCC, Intestinal Stem Cell Consortium (check ratings https://iscc.coh.org/) unknown AB_1078449 Sigma-Aldrich HPA010926 2025-08-19 05:18:22 0
Rabbit Anti-SYNCRIP Polyclonal Antibody, Unconjugated
 
Resource Report
Resource Website
Rating or validation data 		Aviva Systems Biology Cat# ARP40641_T100, RRID:AB_2271535 SYNCRIP other, rat, canine, mouse, fish, zebrafish, human, dog manufacturer recommendations: ELISA; Western Blot; ELISA (titre 1:312500), Western Blot; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_2615120, AB_2271535. polyclonal rabbit AB_2271535 Aviva Systems Biology ARP40641_T100 2025-08-19 05:18:25 0
Anti-CYP11B2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA057752, RRID:AB_2683516 CYP11B2 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683516 Atlas Antibodies HPA057752 2025-08-19 05:18:56 0
Anti-USP35 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA055213, RRID:AB_2682740 USP35 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2682740 Atlas Antibodies HPA055213 2025-08-19 05:18:33 0
Anti-C14orf80 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA039050, RRID:AB_10670918 C14orf80 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10670918 Atlas Antibodies HPA039050 2025-08-19 05:18:33 0
Anti-WFS1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA029128, RRID:AB_10603460 WFS1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10603460 Atlas Antibodies HPA029128 2025-08-19 05:18:33 0
Anti-OSBPL5
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA058727, RRID:AB_2683799 OSBPL5 human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2683799 Atlas Antibodies HPA058727 2025-08-19 05:18:34 0
Anti-SLC1A4
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA034964, RRID:AB_2674386 SLC1A4 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2674386 Atlas Antibodies HPA034964 2025-08-19 05:18:55 0
Anti-SEC23B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA069974, RRID:AB_2686223 SEC23B human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2686223 Atlas Antibodies HPA069974 2025-08-19 05:18:34 0
Anti-SLC28A3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA024729, RRID:AB_1857069 SLC28A3 human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1857069 Atlas Antibodies HPA024729 2025-08-19 05:18:33 0
Anti-GLRA4 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA044759, RRID:AB_10795885 GLRA4 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10795885 Atlas Antibodies HPA044759 2025-08-19 05:18:33 0
Anti-PKD2L2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA041903, RRID:AB_2677734 PKD2L2 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2677734 Atlas Antibodies HPA041903 2025-08-19 05:18:56 0
Anti-NICN1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA037550, RRID:AB_10672599 NICN1 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VPCHVKGSVALQVGDVRTSQGRPGVLVIDVTFPSVAPFELQEITFKNYYTAFLSIRVRQYTSAHTP; Manufacturer approved use: IHC, WB polyclonal rabbit AB_10672599 Atlas Antibodies HPA037550 2025-08-19 05:18:33 0
Anti-ELP6 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA064545, RRID:AB_2685282 ELP6 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2685282 Atlas Antibodies HPA064545 2025-08-19 05:18:56 0
Anti-HDGF
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA048728, RRID:AB_2680503 HDGF human Originating manufacturer of this product. Applications: ICC-IF, IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2680503 Atlas Antibodies HPA048728 2025-08-19 05:18:56 0
H3K4me2-celegans
 
Resource Report
Resource Website
Rating or validation data 		Agilent Cat# 308-34809, RRID:AB_2616535 H3K4me2 caenorhabditis elegans ENCODE PROJECT External validation DATA SET is released testing lot unknown for not specified; status is not eligible for new data unknown mouse AB_2616535 Agilent 308-34809 (also ENCAB420YAH) 2025-08-19 05:18:32 0
Anti-TRA2B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA064972, RRID:AB_2685396 TRA2B human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2685396 Atlas Antibodies HPA064972 2025-08-19 05:18:56 0
Anti-ZNF277 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA027307, RRID:AB_1859164 ZNF277 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1859164 Atlas Antibodies HPA027307 2025-08-19 05:18:55 0
Anti-SRL
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA041535, RRID:AB_2677538 SRL human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2677538 Atlas Antibodies HPA041535 2025-08-19 05:18:56 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X

  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.

Recent News Entries

dkNET community events and announcements in August, 2026

HIRN Funding Opportunity: SPARKS Award

Join the Whole Person Physiome 1st Data Jamboree on August 24-25

Contact Us

Email: info_at_ dknet.org

Stay Connected

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch