Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10883836
Comments: Used By NYUIHC-1413
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality: unknown
Target(s): ND
Proper citation: Bioss Cat# bs-1910R, RRID:AB_10883836 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1843999
Comments: Vendor recommendations: ELISA; Western Blot; Immunoblotting, Indirect ELISA
Host Organism: mouse
Clonality: monoclonal
Target(s): Human TP73L
Proper citation: Sigma-Aldrich Cat# WH0008626M1, RRID:AB_1843999 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845045
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human ARPC5L
Proper citation: Sigma-Aldrich Cat# HPA022013, RRID:AB_1845045 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10961277
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable
Clonality: polyclonal
Target(s): ZNF333 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA043973, RRID:AB_10961277 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10963060
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Clonality: polyclonal
Target(s): FAM159A antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA030744, RRID:AB_10963060 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1953050
Comments: manufacturer recommendations: Western Blot; Immunoprecipitation; Radioimmunoassay; RIP, WB, IPP
Host Organism: rabbit
Clonality: polyclonal
Target(s): PABPC4
Proper citation: MBL International Cat# RN022P, RRID:AB_1953050 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10748369
Comments: Applications: WB, IP, IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): eIF4AIII/EIF4A3
Proper citation: Bethyl Cat# A302-981A, RRID:AB_10748369 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616002
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 122612.RAP for not specified; status is not pursued
Host Organism: mouse
Clonality: unknown
Target(s): PRDM16
Proper citation: CDI Cat# R150.1.2C9, RRID:AB_2616002 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078746
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): EP300
Proper citation: Atlas Antibodies Cat# HPA004112, RRID:AB_1078746 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078975
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GLOD5
Proper citation: Atlas Antibodies Cat# HPA010667, RRID:AB_1078975 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616056
Comments: ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality: unknown
Target(s): Stat92E
Proper citation: Erika Bach Cat# non-commercial Stat92E modENCODE antibody 1, RRID:AB_2616056 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2071525
Comments: Applications: WB, IP, ChIP-Seq
Original Manufacturer
Host Organism: rabbit
Clonality: polyclonal
Target(s): CBX8
Proper citation: Bethyl Cat# A300-882A, RRID:AB_2071525 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2667867
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): NELFE
Proper citation: Atlas Antibodies Cat# HPA007594, RRID:AB_2667867 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683248
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MGAT2
Proper citation: Atlas Antibodies Cat# HPA056824, RRID:AB_2683248 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684779
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): NCBP2
Proper citation: Atlas Antibodies Cat# HPA062483, RRID:AB_2684779 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10611382
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): CARMIL1
Proper citation: Atlas Antibodies Cat# HPA029039, RRID:AB_10611382 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2670712
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SEC14L1
Proper citation: Atlas Antibodies Cat# HPA021463, RRID:AB_2670712 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681368
Host Organism: rabbit
Clonality: unknown
Target(s): PCK2
Proper citation: Sigma-Aldrich Cat# HPA051162, RRID:AB_2681368 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685640
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LRVDRKRKVSGDSSHTETTAEEVPEDPLLKAKRRRVSKDDWPEREMTNSSSNHLEDPHYSELTNLKVCIELTGLHPKKQRHLLHLRERWEQQVSAADGKPG; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): BCOR
Proper citation: Atlas Antibodies Cat# HPA066234, RRID:AB_2685640 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2677115
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ESRP2
Proper citation: Atlas Antibodies Cat# HPA040751, RRID:AB_2677115 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.