Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2673968
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): VHL
Proper citation: Atlas Antibodies Cat# HPA031631, RRID:AB_2673968 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2668069
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MAGI3
Proper citation: Atlas Antibodies Cat# HPA008444, RRID:AB_2668069 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2666177
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PROX1
Proper citation: Atlas Antibodies Cat# HPA001030, RRID:AB_2666177 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683999
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): DPP7
Proper citation: Atlas Antibodies Cat# HPA059381, RRID:AB_2683999 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2047958
Comments: ENCODE PROJECT External validation DATA SET is released testing lot QC11166 for not specified; status is awaiting lab characterization; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_2615146, AB_2047958.
Host Organism: rabbit
Clonality: unknown
Target(s): SRSF3
Proper citation: Aviva Systems Biology Cat# ARP40438_P050, RRID:AB_2047958 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2675023
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RLVITNGMVIPNYSSRTEYEKLFALGVTMYGQMTAGSYCYIGPQGIVHGTVLTVLNAARRYLGIEDLAGKVFVTSGLGGMSGAQAKAAVIVGCIG; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): UROC1
Proper citation: Atlas Antibodies Cat# HPA036254, RRID:AB_2675023 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2732677
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): RC3H2
Proper citation: Atlas Antibodies Cat# HPA062144, RRID:AB_2732677 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10796238
Host Organism: rabbit
Clonality: polyclonal
Target(s): ANGPTL6 antibody produced in rabbit
Proper citation: Atlas Antibodies Cat# HPA041171, RRID:AB_10796238 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10001196
Comments: Applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen
Host Organism: Rabbit
Clonality: polyclonal
Target(s): GAP-43
Proper citation: Novus Cat# NB300-143, RRID:AB_10001196 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10671930
Host Organism: rabbit
Clonality: polyclonal
Target(s): RAD54L2 antibody produced in rabbit
Proper citation: Atlas Antibodies Cat# HPA035004, RRID:AB_10671930 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683528
Host Organism: rabbit
Clonality: unknown
Target(s): RPS15
Proper citation: Sigma-Aldrich Cat# HPA057793, RRID:AB_2683528 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10965556
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Clonality: polyclonal
Target(s): WIBG antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA046200, RRID:AB_10965556 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10959463
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): IFT80
Proper citation: Atlas Antibodies Cat# HPA035868, RRID:AB_10959463 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2675271
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CD34
Proper citation: Atlas Antibodies Cat# HPA036722, RRID:AB_2675271 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_420948
Comments: Applications: WB, IP, IHC
Original Manufacturer
Host Organism: rabbit
Clonality: polyclonal
Target(s): PNUTS
Proper citation: Bethyl Cat# A300-439A, RRID:AB_420948 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853591
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MASTL
Proper citation: Atlas Antibodies Cat# HPA027175, RRID:AB_1853591 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854992
Comments: Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): PASK antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA016450, RRID:AB_1854992 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673351
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TTC26
Proper citation: Atlas Antibodies Cat# HPA036338, RRID:AB_10673351 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080065
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SOX6
Proper citation: Atlas Antibodies Cat# HPA001923, RRID:AB_1080065 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684604
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): HES6
Proper citation: Atlas Antibodies Cat# HPA061763, RRID:AB_2684604 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.