Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 294 showing 5861 ~ 5880 out of 55,392 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection
  • RRID:AB_572251

    This resource has 50+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_572251

Comments: Manufacturer Applications: Immunohistochemistry, Immunocytochemistry, Immunofluoresence, Western Blot; Note, The Mu Opioid Receptor antiserum was quality control tested using standard immunohistochemical methods. The antiserum demonstrates strongly positive labeling of rat caudate putamen and spinal cord (dorsal horn) using indirect immunofluorescent and biotin/avidin-HRP techniques. Recommended primary dilutions are 1/500 - 1/1000 in PBS/0.3% Triton X-100 - Cy3 Technique and 1/6000 - 1/10000 in PBS/0.3% Triton X-100 - Biotin/avidin-HRP Technique. Preadsorption with MOR peptide (384-398) at 10 µg/ml completely eliminates labeling. The specificity of the antiserum was determined by immunolabeling of transfected cells, Western Blot analysis and immunoisolation studies.; Gene Symbol:
Host Organism: rabbit
Clonality: polyclonal
Target(s): Synthetic rat MOR1 (384-398)

Proper citation: ImmunoStar Cat# 24216, RRID:AB_572251 Copy   


Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10630605

Comments: Applications: WB, IP, IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): API5

Proper citation: Bethyl Cat# A302-784A, RRID:AB_10630605 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10672519

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): NHLRC2

Proper citation: Atlas Antibodies Cat# HPA038493, RRID:AB_10672519 Copy   


  • RRID:AB_2682171

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2682171

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): PCK2

Proper citation: Atlas Antibodies Cat# HPA053502, RRID:AB_2682171 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10601563

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): AKR1B1

Proper citation: Atlas Antibodies Cat# HPA026425, RRID:AB_10601563 Copy   


  • RRID:AB_1079944

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1079944

Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): SGCA

Proper citation: Atlas Antibodies Cat# HPA007537, RRID:AB_1079944 Copy   


  • RRID:AB_10672396

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10672396

Comments: Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): WAPL

Proper citation: Atlas Antibodies Cat# HPA037875, RRID:AB_10672396 Copy   


  • RRID:AB_2615905

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2615905

Comments: ENCODE PROJECT External validation DATA SET is released testing lot 20141119.LRH for not specified; status is not pursued
Host Organism: mouse
Clonality: unknown
Target(s): DPF1

Proper citation: CDI Cat# R1172.1.1B3, RRID:AB_2615905 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2681030

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): METTL10

Proper citation: Atlas Antibodies Cat# HPA050138, RRID:AB_2681030 Copy   


  • RRID:AB_10602421

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10602421

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): METAP1D

Proper citation: Atlas Antibodies Cat# HPA030299, RRID:AB_10602421 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686530

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): YEATS4

Proper citation: Atlas Antibodies Cat# HPA072532, RRID:AB_2686530 Copy   


  • RRID:AB_10611114

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10611114

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): USF3

Proper citation: Atlas Antibodies Cat# HPA029243, RRID:AB_10611114 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2683915

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FUNDC2

Proper citation: Atlas Antibodies Cat# HPA059129, RRID:AB_2683915 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10601766

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KRVNAAFYRLLAQRQQHSFGLHGVACVGTEAHLSLCSLEFYRANDTARCP; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): LOXL3

Proper citation: Atlas Antibodies Cat# HPA035281, RRID:AB_10601766 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2677990

Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): COL7A1

Proper citation: Atlas Antibodies Cat# HPA042420, RRID:AB_2677990 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686880

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): HOXA2

Proper citation: Atlas Antibodies Cat# HPA078220, RRID:AB_2686880 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1079386

Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MIPOL1

Proper citation: Atlas Antibodies Cat# HPA002893, RRID:AB_1079386 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10795259

Host Organism: rabbit
Clonality: polyclonal
Target(s): CCDC83 antibody produced in rabbit

Proper citation: Atlas Antibodies Cat# HPA039707, RRID:AB_10795259 Copy   


  • RRID:AB_2684704

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2684704

Host Organism: rabbit
Clonality: unknown
Target(s): TPD52

Proper citation: Sigma-Aldrich Cat# HPA062167, RRID:AB_2684704 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1857783

Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Western Blot; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): TAX1BP1 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA024432, RRID:AB_1857783 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within dkNET that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X