Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-VNN3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA010818, RRID:AB_1080572 VNN3 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EGQYYLQICALLKCQTTDLETCGEPVGSAFTKFEDFSLSGTFGTRYVFPQIILSGSQLAPERHYEISRDGRLRSRSGAPLPVLVMALYGRVFEKDPPRLGQGSGKFQ; Manufacturer approved use: IHC polyclonal rabbit AB_1080572 Atlas Antibodies HPA010818 2025-08-19 05:44:46 0
Anti-SERINC2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA005974, RRID:AB_10603239 SERINC2 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10603239 Atlas Antibodies HPA005974 2025-08-19 05:44:48 0
Anti-ZNF20 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA020887, RRID:AB_2218842 ZNF20 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2218842 Atlas Antibodies HPA020887 2025-08-19 05:44:48 0
Anti-ALDH1B1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA021037, RRID:AB_1844724 ALDH1B1 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1844724 Atlas Antibodies HPA021037 2025-08-19 05:44:46 0
Anti-PCSK6 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA004774, RRID:AB_1079583 PCSK6 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1079583 Atlas Antibodies HPA004774 2025-08-19 05:45:55 0
Rabbit anti-BHC110/LSD1 Antibody, Affinity Purified
 
Resource Report
Resource Website
Discontinued
Rating or validation data
Bethyl Cat# A300-216A, RRID:AB_242534 BHC110/LSD1 human Applications: WB, IHC polyclonal rabbit AB_242534 Bethyl A300-216A (also A300-216A-M, A300-216A-T) 2025-08-19 05:45:54 0
Anti-EIF4E3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA058649, RRID:AB_2683785 EIF4E3 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683785 Atlas Antibodies HPA058649 2025-08-19 05:46:27 0
Anti-MDP1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA003064, RRID:AB_10602350 MDP1 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10602350 Atlas Antibodies HPA003064 2025-08-19 05:46:26 0
Anti-KCNJ3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA024231, RRID:AB_1855558 KCNJ3 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1855558 Atlas Antibodies HPA024231 2025-08-19 05:45:55 0
Rabbit anti-IRF8 Antibody, Affinity Purified
 
Resource Report
Resource Website
Discontinued
Rating or validation data
Bethyl Cat# A304-026A, RRID:AB_2620374 IRF8 mouse Applications: IP
Original Manufacturer
polyclonal rabbit AB_2620374 Bethyl A304-026A (also OWL-A19509, A304-026A-T) 2025-08-19 05:46:24 0
Anti-THUMPD3 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA036170, RRID:AB_10671836 THUMPD3 antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry polyclonal rabbit AB_10671836 Sigma-Aldrich HPA036170 2025-08-19 05:45:58 0
Anti-NDC1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA070882, RRID:AB_2686320 NDC1 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2686320 Atlas Antibodies HPA070882 2025-08-19 05:46:28 0
Anti-BCAS1
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA051816, RRID:AB_2681623 BCAS1 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2681623 Atlas Antibodies HPA051816 2025-08-19 05:45:59 0
Anti-SRRM1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA049941, RRID:AB_2680962 SRRM1 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680962 Atlas Antibodies HPA049941 2025-08-19 05:46:27 0
Anti-DENND2A polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA021778, RRID:AB_2670818 DENND2A human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence DGQEDYLPSSTVERRSSDGVRTQVTEAKNGMRPGTESTEKERNKGAVNVGGQDPEPGQDLSQPEREVDPSWGRGREPRLGKLRFQNDPLSV; Manufacturer approved use: IHC, WB polyclonal rabbit AB_2670818 Atlas Antibodies HPA021778 2025-08-19 05:46:26 0
Anti-ATAD3B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA058968, RRID:AB_2683864 ATAD3B human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683864 Atlas Antibodies HPA058968 2025-08-19 05:45:56 0
Anti-EPS8L1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA041851, RRID:AB_2677706 EPS8L1 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2677706 Atlas Antibodies HPA041851 2025-08-19 05:45:56 0
Anti-PIEZO2 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA015986, RRID:AB_1848395 PIEZO2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1848395 Atlas Antibodies HPA015986 2025-08-19 05:45:55 1
Anti-ANKRD12 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA040705, RRID:AB_10673301 ANKRD12 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10673301 Atlas Antibodies HPA040705 2025-08-19 05:46:27 0
Anti-GAA
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA026970, RRID:AB_2672065 GAA human unknown rabbit AB_2672065 Sigma-Aldrich HPA026970 2025-08-19 05:45:58 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.