Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
CD44 Antibody (OX-50) - BSA Free Resource Report Resource Website Rating or validation data |
Novus Cat# NB600-1317, RRID:AB_10002839 | CD44 | Rat | OX-50 |
Applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, CyTOF-ready Validation: data for WB is available from YCharOS. https://doi.org/10.5281/zenodo.4730966 |
monoclonal | Mouse | AB_10002839 | Novus | NB600-1317 (also NB600-1317SS) | 2025-08-19 05:48:55 | 0 | |
|
Anti-UBAC1 polyclonal antibody Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA005651, RRID:AB_1858489 | UBAC1 | rat, mouse, human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1858489 | Atlas Antibodies | HPA005651 | 2025-08-19 05:48:40 | 1 | ||
|
Anti-PCNT antibody produced in rabbit Resource Report Resource Website 1+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA016820, RRID:AB_1855079 | Human PCNT | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1855079 | Sigma-Aldrich | HPA016820 | 2025-08-19 05:49:20 | 1 | ||
|
Anti-TMCO5B antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA014911, RRID:AB_1858062 | TMCO5B antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_1858062 | Sigma-Aldrich | HPA014911 | 2025-08-19 05:49:58 | 0 | ||
|
Anti-ING2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA021517, RRID:AB_10601914 | ING2 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry | polyclonal | rabbit | AB_10601914 | Sigma-Aldrich | HPA021517 | 2025-08-19 05:49:32 | 0 | ||
|
Anti-AKAP8 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA004776, RRID:AB_1078122 | Human AKAP8 | human | Vendor recommendations: | unknown | rabbit | AB_1078122 | Sigma-Aldrich | HPA004776 | 2025-08-19 05:53:18 | 0 | ||
|
Anti-URB1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA018334, RRID:AB_1856088 | Human URB1 | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1856088 | Sigma-Aldrich | HPA018334 | 2025-08-19 05:53:30 | 0 | ||
|
Anti-TRPC3 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA037969, RRID:AB_10697090 | TRPC3 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence NFPKCRRRRLQKDIEMGMGNSKSRLNLFTQSNSRVFESHSFNSILNQPTRYQQI; Manufacturer approved use: IHC, WB | polyclonal | rabbit | AB_10697090 | Atlas Antibodies | HPA037969 | 2025-08-19 05:53:27 | 0 | ||
|
ANTI-DEPTOR antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA024011, RRID:AB_1847608 | Human DEPDC6 | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1847608 | Sigma-Aldrich | HPA024011 | 2025-08-19 05:53:28 | 0 | ||
|
Anti-BARHL1 antibody produced in rabbit Resource Report Resource Website 1+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA004809, RRID:AB_1078266 | BARHL1 antibody produced in rabbit | human | Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_1078266 | Sigma-Aldrich | HPA004809 | 2025-08-19 05:53:34 | 5 | ||
|
Anti-TCEANC2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA046918, RRID:AB_2679864 | TCEANC2 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2679864 | Atlas Antibodies | HPA046918 | 2025-08-19 05:53:38 | 0 | ||
|
Anti-OSBPL1A antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA040959, RRID:AB_10964295 | OSBPL1A antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | AB_10964295 | Sigma-Aldrich | HPA040959 | 2025-08-19 05:53:42 | 0 | |||
|
Anti-TMEM208 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA041868, RRID:AB_10962347 | TMEM208 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable | polyclonal | AB_10962347 | Sigma-Aldrich | HPA041868 | 2025-08-19 05:53:43 | 0 | |||
|
Rabbit Anti-ID3 Polyclonal Antibody, Unconjugated Resource Report Resource Website Rating or validation data |
Bioss Cat# bs-6229R, RRID:AB_2615881 | Rabbit ID3 | rat, porcine, canine, cow, pig, horse, mouse, bovine, dog, human, sheep | manufacturer recommendations: IgG ELISA(1:500-1000), IP(1:20-100), IHC-P(1:100-500), IHC-F(1:100-500), Flow-Cyt(1:20-100), IF(1:50-200); The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_11044817, AB_2615881. | polyclonal | AB_2615881 | Bioss | bs-6229R | 2025-08-19 05:53:47 | 0 | |||
|
Anti-PHF6 polyclonal antibody Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA001023, RRID:AB_1079606 | PHF6 | Human, Rat, Mouse | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1079606 | Atlas Antibodies | HPA001023 | 2025-08-19 05:54:10 | 3 | ||
|
Phospho-PTEN (Ser380/Thr382/383) Antibody Resource Report Resource Website 1+ mentions Rating or validation data |
Cell Signaling Technology Cat# 9554, RRID:AB_331411 | rat, mouse, human |
Applications: W, IP Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE |
unknown | rabbit | AB_331411 | Cell Signaling Technology | 9554 | 2025-08-19 05:54:18 | 3 | |||
|
Alexa Fluor(R) 700 anti-human CD38 Resource Report Resource Website 1+ mentions Rating or validation data |
BioLegend Cat# 303524, RRID:AB_2072781 | CD38 | human | Clone HIT2 | Applications: FC, SB | monoclonal | mouse | AB_2072781 | BioLegend | 303524 (also 303523) | 2025-08-19 05:54:12 | 5 | |
|
Rabbit anti-TFIP11 Antibody, Affinity Purified Resource Report Resource Website Discontinued Rating or validation data |
Bethyl Cat# A302-548A, RRID:AB_1999071 | TFIP11 | human |
Applications: WB, IP, IHC Original Manufacturer |
polyclonal | rabbit | AB_1999071 | Bethyl | A302-548A (also A302-548A-M, A302-548A-T) | 2025-08-19 05:50:09 | 0 | ||
|
Anti-NSDHL antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA000248, RRID:AB_1079507 | Human NSDHL | human | Vendor recommendations: | unknown | rabbit | AB_1079507 | Sigma-Aldrich | HPA000248 | 2025-08-19 05:49:42 | 0 | ||
|
Anti-LRRC68 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA041500, RRID:AB_10795122 | LRRC68 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry | polyclonal | rabbit | AB_10795122 | Sigma-Aldrich | HPA041500 | 2025-08-19 05:50:06 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
