Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 274 showing 5461 ~ 5480 out of 1,488,694 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2294223

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FRRS1

Proper citation: Atlas Antibodies Cat# HPA017883, RRID:AB_2294223 Copy   


  • RRID:AB_1849138

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1849138

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): FZD6

Proper citation: Atlas Antibodies Cat# HPA017991, RRID:AB_1849138 Copy   


  • RRID:AB_1849586

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1849586

Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): GDF3

Proper citation: Atlas Antibodies Cat# HPA018468, RRID:AB_1849586 Copy   


  • RRID:AB_1846110

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1846110

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CBR3

Proper citation: Atlas Antibodies Cat# HPA018434, RRID:AB_1846110 Copy   


  • RRID:AB_1847384

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1847384

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CCNE1

Proper citation: Atlas Antibodies Cat# HPA018169, RRID:AB_1847384 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1852904

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): LPIN2

Proper citation: Atlas Antibodies Cat# HPA017857, RRID:AB_1852904 Copy   


  • RRID:AB_1849683

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1849683

Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): GIMAP8

Proper citation: Atlas Antibodies Cat# HPA017765, RRID:AB_1849683 Copy   


  • RRID:AB_1859012

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1859012

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): ZFAND5

Proper citation: Atlas Antibodies Cat# HPA018129, RRID:AB_1859012 Copy   


  • RRID:AB_1858640

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1858640

Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): UPK3A

Proper citation: Atlas Antibodies Cat# HPA018415, RRID:AB_1858640 Copy   


  • RRID:AB_1855373

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1855373

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PIGS

Proper citation: Atlas Antibodies Cat# HPA018149, RRID:AB_1855373 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1859483

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GVNMEELMSKLSAVPGISSVHEVHIWELVSGKIIATLHIKYPKDRGYQDASTKIREIFHHAGIHNVTIQFENVDLKEPLEQKDLLLLCNSPCISKGCAKQLCCPPGALPLAHVNGCAEHNGGPSLDTYGSDGLSRRDAREVAIEVS; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): SLC30A10

Proper citation: Atlas Antibodies Cat# HPA017989, RRID:AB_1859483 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1855045

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality: polyclonal
Target(s): PCDH18

Proper citation: Atlas Antibodies Cat# HPA017976, RRID:AB_1855045 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1854958

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PLPPR5

Proper citation: Atlas Antibodies Cat# HPA018072, RRID:AB_1854958 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2190518

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SLC38A6

Proper citation: Atlas Antibodies Cat# HPA018508, RRID:AB_2190518 Copy   


  • RRID:AB_1856135

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1856135

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RBM5

Proper citation: Atlas Antibodies Cat# HPA018011, RRID:AB_1856135 Copy   


  • RRID:AB_2620151

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2620151

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RANBP2

Proper citation: Atlas Antibodies Cat# HPA018437, RRID:AB_2620151 Copy   


  • RRID:AB_1854962

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1854962

Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): PAPPA2

Proper citation: Atlas Antibodies Cat# HPA018412, RRID:AB_1854962 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2669660

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KLHL8

Proper citation: Atlas Antibodies Cat# HPA017762, RRID:AB_2669660 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1856048

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SLC50A1

Proper citation: Atlas Antibodies Cat# HPA018095, RRID:AB_1856048 Copy   


  • RRID:AB_2669753

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2669753

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SQLE

Proper citation: Atlas Antibodies Cat# HPA018038, RRID:AB_2669753 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within dkNET that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X