Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10002839
Comments: Applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, CyTOF-ready
Validation: data for WB is available from YCharOS. https://doi.org/10.5281/zenodo.4730966
Host Organism: Mouse
Clonality: monoclonal
Target(s): CD44
Proper citation: Novus Cat# NB600-1317, RRID:AB_10002839 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858489
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): UBAC1
Proper citation: Atlas Antibodies Cat# HPA005651, RRID:AB_1858489 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855079
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human PCNT
Proper citation: Sigma-Aldrich Cat# HPA016820, RRID:AB_1855079 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858062
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): TMCO5B antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA014911, RRID:AB_1858062 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601914
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): ING2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA021517, RRID:AB_10601914 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078122
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality: unknown
Target(s): Human AKAP8
Proper citation: Sigma-Aldrich Cat# HPA004776, RRID:AB_1078122 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1856088
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human URB1
Proper citation: Sigma-Aldrich Cat# HPA018334, RRID:AB_1856088 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10697090
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence NFPKCRRRRLQKDIEMGMGNSKSRLNLFTQSNSRVFESHSFNSILNQPTRYQQI; Manufacturer approved use: IHC, WB
Host Organism: rabbit
Clonality: polyclonal
Target(s): TRPC3
Proper citation: Atlas Antibodies Cat# HPA037969, RRID:AB_10697090 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847608
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human DEPDC6
Proper citation: Sigma-Aldrich Cat# HPA024011, RRID:AB_1847608 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078266
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): BARHL1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA004809, RRID:AB_1078266 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679864
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TCEANC2
Proper citation: Atlas Antibodies Cat# HPA046918, RRID:AB_2679864 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10964295
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Clonality: polyclonal
Target(s): OSBPL1A antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA040959, RRID:AB_10964295 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10962347
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Clonality: polyclonal
Target(s): TMEM208 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA041868, RRID:AB_10962347 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2615881
Comments: manufacturer recommendations: IgG ELISA(1:500-1000), IP(1:20-100), IHC-P(1:100-500), IHC-F(1:100-500), Flow-Cyt(1:20-100), IF(1:50-200); The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_11044817, AB_2615881.
Clonality: polyclonal
Target(s): Rabbit ID3
Proper citation: Bioss Cat# bs-6229R, RRID:AB_2615881 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079606
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PHF6
Proper citation: Atlas Antibodies Cat# HPA001023, RRID:AB_1079606 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_331411
Comments: Applications: W, IP
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality: unknown
Proper citation: Cell Signaling Technology Cat# 9554, RRID:AB_331411 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2072781
Comments: Applications: FC, SB
Host Organism: mouse
Clonality: monoclonal
Target(s): CD38
Proper citation: BioLegend Cat# 303524, RRID:AB_2072781 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1999071
Comments: Applications: WB, IP, IHC
Original Manufacturer
Host Organism: rabbit
Clonality: polyclonal
Target(s): TFIP11
Proper citation: Bethyl Cat# A302-548A, RRID:AB_1999071 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079507
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality: unknown
Target(s): Human NSDHL
Proper citation: Sigma-Aldrich Cat# HPA000248, RRID:AB_1079507 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795122
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): LRRC68 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA041500, RRID:AB_10795122 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.