Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-CFAP74
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA029274, RRID:AB_10601997 CFAP74 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10601997 Atlas Antibodies HPA029274 2025-08-19 07:48:40 0
Mammaglobin
 
Resource Report
Resource Website
Rating or validation data
Zeta Corporation Cat# Z2011, RRID:AB_2336025 Recombinant full length protein [304-1A5 & 31-A5] Used By NYUIHC-477
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
monoclonal mouse AB_2336025 Zeta Corporation Z2011 2025-08-19 07:49:21 0
Multiple myeloma oncogen-1 protein
 
Resource Report
Resource Website
Rating or validation data
Ventana Medical Systems Cat# 760-4529, RRID:AB_2336009 MUM1 protein is expressed in a wide spectrum of hematolymphoid neoplasms and in malignant melanoma. [MRQ-43] Used By NYUIHC-1398
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
monoclonal rabbit AB_2336009 Ventana Medical Systems 760-4529 2025-08-19 07:48:57 0
Anti-CLCN5 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA000401, RRID:AB_1078531 CLCN5 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1078531 Atlas Antibodies HPA000401 2025-08-19 07:49:31 0
Anti-HTATSF1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA000504, RRID:AB_10752094 HTATSF1 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10752094 Atlas Antibodies HPA000504 2025-08-19 07:49:13 0
HES1-human
 
Resource Report
Resource Website
Rating or validation data
CDI Cat# R159.1.4A11, RRID:AB_2615998 HES1 Homo sapiens ENCODE PROJECT External validation DATA SET is released testing lot 20130125.RAP for not specified; status is not pursued unknown mouse AB_2615998 CDI R159.1.4A11 (also ENCAB000BEQ) 2025-08-19 07:49:30 0
Anti-FAM151A
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA016840, RRID:AB_2669461 FAM151A human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2669461 Atlas Antibodies HPA016840 2025-08-19 07:49:13 0
Anti-CD1E polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA057769, RRID:AB_2683522 CD1E human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683522 Atlas Antibodies HPA057769 2025-08-19 07:49:32 0
Anti-INCENP polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA070550, RRID:AB_2686279 INCENP human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2686279 Atlas Antibodies HPA070550 2025-08-19 07:49:14 0
Anti-CACNG6 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA056615, RRID:AB_2683192 CACNG6 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683192 Atlas Antibodies HPA056615 2025-08-19 07:49:32 0
Anti-SIX2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA056958, RRID:AB_2683287 SIX2 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683287 Atlas Antibodies HPA056958 2025-08-19 07:49:14 0
Anti-GUCA1B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA031453, RRID:AB_10602602 GUCA1B human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence QLKKACRRELQTEQGQLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKMLQMDMNPSSWLAQQRRK; Manufacturer approved use: IHC polyclonal rabbit AB_10602602 Atlas Antibodies HPA031453 2025-08-19 07:49:13 0
Anti-LRPPRC
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA036409, RRID:AB_2675108 LRPPRC human unknown rabbit AB_2675108 Sigma-Aldrich HPA036409 2025-08-19 07:49:16 0
Anti-KCNE2
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA029706, RRID:AB_2673159 KCNE2 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2673159 Atlas Antibodies HPA029706 2025-08-19 07:49:32 0
Anti-FAM186B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA039736, RRID:AB_10795295 FAM186B human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10795295 Atlas Antibodies HPA039736 2025-08-19 07:49:32 0
Anti-TCF7 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA070505, RRID:AB_2686275 TCF7 human Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2686275 Atlas Antibodies HPA070505 2025-08-19 07:49:32 0
Anti-DZANK1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA064255, RRID:AB_2685228 DZANK1 human Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2685228 Atlas Antibodies HPA064255 2025-08-19 07:49:32 0
Anti-PUSL1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA039999, RRID:AB_2676792 PUSL1 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2676792 Atlas Antibodies HPA039999 2025-08-19 07:49:14 0
Anti-FAM83G antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA023369, RRID:AB_1848415 FAM83G antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other; Western Blot polyclonal rabbit AB_1848415 Sigma-Aldrich HPA023369 2025-08-19 06:07:21 0
Anti-CMTM2 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA014741, RRID:AB_1846995 CMTM2 antibody produced in rabbit human Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal rabbit AB_1846995 Sigma-Aldrich HPA014741 2025-08-19 06:07:15 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.