Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078194
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): ARHGAP1
Proper citation: Atlas Antibodies Cat# HPA004689, RRID:AB_1078194 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846205
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): CCT8
Proper citation: Atlas Antibodies Cat# HPA021051, RRID:AB_1846205 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079468
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): NRXN3
Proper citation: Atlas Antibodies Cat# HPA002727, RRID:AB_1079468 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078312
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAM213A
Proper citation: Atlas Antibodies Cat# HPA009025, RRID:AB_1078312 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079577
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PCDHGA2
Proper citation: Atlas Antibodies Cat# HPA008755, RRID:AB_1079577 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601028
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence GRLLEQVGTMALWASQREKEVLRRERAVEWRERAVEKRERALEEVERAILEMKWKVRAEKEACQREKELPAAVHPFH; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZBED2
Proper citation: Atlas Antibodies Cat# HPA029786, RRID:AB_10601028 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2674146
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KAZN
Proper citation: Atlas Antibodies Cat# HPA032095, RRID:AB_2674146 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10671583
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): NEK1
Proper citation: Atlas Antibodies Cat# HPA020873, RRID:AB_10671583 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852576
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KLHL14
Proper citation: Atlas Antibodies Cat# HPA024777, RRID:AB_1852576 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846341
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): CD93
Proper citation: Atlas Antibodies Cat# HPA012368, RRID:AB_1846341 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603019
Host Organism: rabbit
Clonality: polyclonal
Target(s): MID2 antibody produced in rabbit
Proper citation: Atlas Antibodies Cat# HPA029077, RRID:AB_10603019 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853057
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human MSL1
Proper citation: Sigma-Aldrich Cat# HPA022800, RRID:AB_1853057 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849971
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human GREM1
Proper citation: Sigma-Aldrich Cat# HPA007526, RRID:AB_1849971 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849841
Comments: Vendor recommendations: Immunohistochemistry; Immunofluorescence; Western Blot; Other; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): GOLGA2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA021799, RRID:AB_1849841 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849760
Comments: Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): SLC2A8 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA011935, RRID:AB_1849760 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849651
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human GGTA1
Proper citation: Sigma-Aldrich Cat# HPA023262, RRID:AB_1849651 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855370
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PIGR
Proper citation: Atlas Antibodies Cat# HPA006154, RRID:AB_1855370 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858529
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): UBE2I
Proper citation: Atlas Antibodies Cat# HPA003909, RRID:AB_1858529 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_302842
Comments: Used By NYUIHC-874
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality: unknown
Target(s): Recombinant 153 aa human IL-1beta produced in E.coli. MW of recombinant IL-1beta 15kDa, with the N-terminal amino acid at position alanine 117. This is the cleavage site generated by the IL-1beta converting enzyme (ICE, capase-1).
Proper citation: Abcam Cat# ab2105, RRID:AB_302842 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2313685
Comments: Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Clonality: unknown
Proper citation: Ultraclone Cat# RA95101, RRID:AB_2313685 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.