Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079195
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): TTC28 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA003099, RRID:AB_1079195 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600879
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): ITGB8 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA027797, RRID:AB_10600879 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673233
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): IPO4 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA039043, RRID:AB_10673233 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603030
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): SMARCC1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA026853, RRID:AB_10603030 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601017
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): GPATCH4 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA028323, RRID:AB_10601017 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_442114
Comments: Used By NYUIHC-306
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality: monoclonal
Target(s): Synthetic peptide of the muc-6 tandem repeat sequence
Proper citation: Leica Biosystems Cat# NCL-MUC-6, RRID:AB_442114 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852509
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human KIFC3
Proper citation: Sigma-Aldrich Cat# HPA021240, RRID:AB_1852509 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681690
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CUL9
Proper citation: Atlas Antibodies Cat# HPA052004, RRID:AB_2681690 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616302
Comments: ENCODE PROJECT External validation for lot# W001 is available under ENCODE ID: ENCAB794QWB
Host Organism: mouse
Clonality: monoclonal
Target(s): NR4A3
Proper citation: OriGene Cat# TA804854, RRID:AB_2616302 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853843
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): MFAP5
Proper citation: Atlas Antibodies Cat# HPA010553, RRID:AB_1853843 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2678548
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): SAE1
Proper citation: Atlas Antibodies Cat# HPA043552, RRID:AB_2678548 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794754
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): OSGEP
Proper citation: Atlas Antibodies Cat# HPA039751, RRID:AB_10794754 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679770
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): CES1
Proper citation: Atlas Antibodies Cat# HPA046717, RRID:AB_2679770 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078490
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CDK3
Proper citation: Atlas Antibodies Cat# HPA007420, RRID:AB_1078490 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681125
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TBRG4
Proper citation: Atlas Antibodies Cat# HPA050430, RRID:AB_2681125 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601025
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence YAFFHPNGPRFGQSPSCACEDPAAAFTLPPDVATSTLRSISNNRSVVSDRDQKFAERDGCVPVFQVRPTAPSTPSSRPPRIEESVIKIDLFR; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): XKR4
Proper citation: Atlas Antibodies Cat# HPA028083, RRID:AB_10601025 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1855072
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): PCM1
Proper citation: Atlas Antibodies Cat# HPA023370, RRID:AB_1855072 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670160
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): METTL21A
Proper citation: Atlas Antibodies Cat# HPA034712, RRID:AB_10670160 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685285
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RASA1
Proper citation: Atlas Antibodies Cat# HPA064556, RRID:AB_2685285 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10793947
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): MARCH3
Proper citation: Atlas Antibodies Cat# HPA043406, RRID:AB_10793947 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.