Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Anti-SH3D21 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA042456, RRID:AB_10959746 | SH3D21 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable | polyclonal | AB_10959746 | Sigma-Aldrich | HPA042456 | 2025-08-19 07:13:07 | 0 | |||
|
Anti-FHDC1 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA008527, RRID:AB_2104099 | FHDC1 | human | Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2104099 | Atlas Antibodies | HPA008527 | 2025-08-19 07:13:28 | 0 | ||
|
Anti-RNH1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA040781, RRID:AB_10796227 | RNH1 antibody produced in rabbit | human | Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry | polyclonal | rabbit | AB_10796227 | Sigma-Aldrich | HPA040781 | 2025-08-19 07:13:28 | 0 | ||
|
Rabbit anti-SAM68 Antibody, Affinity Purified Resource Report Resource Website 1+ mentions Discontinued Rating or validation data |
Bethyl Cat# A302-110A, RRID:AB_1604287 | SAM68 | human | Applications: WB, IP, IHC | polyclonal | rabbit | AB_1604287 | Bethyl | A302-110A (also A302-110A-M, A302-110A-T) | 2025-08-19 07:12:40 | 1 | ||
|
Anti-SPN polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA055244, RRID:AB_2682756 | SPN | human | Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2682756 | Atlas Antibodies | HPA055244 | 2025-08-19 07:12:43 | 0 | ||
|
Anti-WDR43 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA044733, RRID:AB_10959613 | WDR43 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | AB_10959613 | Sigma-Aldrich | HPA044733 | 2025-08-19 07:12:53 | 0 | |||
|
Anti-HS2ST1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA043069, RRID:AB_10964127 | HS2ST1 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | AB_10964127 | Sigma-Aldrich | HPA043069 | 2025-08-19 07:13:33 | 0 | |||
|
Anti-NPRL3 antibody produced in rabbit Resource Report Resource Website 1+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA011741, RRID:AB_1845577 | NPRL3 antibody produced in rabbit | human | Vendor recommendations: Other; Western Blot; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable | polyclonal | rabbit | AB_1845577 | Sigma-Aldrich | HPA011741 | 2025-08-19 07:12:48 | 2 | ||
|
Anti-ZMYND10 polyclonal antibody Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA035255, RRID:AB_10601928 | ZMYND10 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MGDLELLLPGEAEVLVRGLRSFPLREMGSEGWNQQHENLEKLNMQAILDATVSQGEPIQELLVTHGKVPTLVEELIAVEMWKQKVFPVFCRVEDFKPQNT; Manufacturer approved use: ICC-IF, IHC | polyclonal | rabbit | AB_10601928 | Atlas Antibodies | HPA035255 | 2025-08-19 07:13:41 | 1 | ||
|
Anti-LEPREL2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA043695, RRID:AB_10797146 | LEPREL2 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other | polyclonal | rabbit | AB_10797146 | Sigma-Aldrich | HPA043695 | 2025-08-19 07:15:50 | 0 | ||
|
Rabbit anti-SRC1 Antibody, Affinity Purified Resource Report Resource Website Discontinued Rating or validation data |
Bethyl Cat# A300-344A, RRID:AB_2196323 | SRC1 | human | Applications: WB, IP | polyclonal | rabbit | AB_2196323 | Bethyl | A300-344A (also ENCAB585QVB) | 2025-08-19 07:16:22 | 0 | ||
|
Anti-BZRAP1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA025244, RRID:AB_1845509 | Human BZRAP1 | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1845509 | Sigma-Aldrich | HPA025244 | 2025-08-19 07:16:23 | 0 | ||
|
Anti-C17orf70 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA023954, RRID:AB_1845601 | C17orf70 antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable | polyclonal | rabbit | AB_1845601 | Sigma-Aldrich | HPA023954 | 2025-08-19 07:15:49 | 0 | ||
|
E2F1-human Resource Report Resource Website Rating or validation data |
GeneTex Cat# GTX101235, RRID:AB_1950159 | E2F1 | human | ENCODE PROJECT External validation DATA SET is released testing lot 39812 for K562; status is awaiting lab characterization | polyclonal | rabbit | AB_1950159 | GeneTex | GTX101235 | 2025-08-19 07:16:48 | 0 | ||
|
Anti-AC117834.1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA045111, RRID:AB_10960842 | AC117834.1 antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | AB_10960842 | Sigma-Aldrich | HPA045111 | 2025-08-19 07:16:45 | 0 | |||
|
Anti-CPSF2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA024238, RRID:AB_1847200 | CPSF2 antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable | polyclonal | rabbit | AB_1847200 | Sigma-Aldrich | HPA024238 | 2025-08-19 07:16:25 | 0 | ||
|
Anti-TSKS antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA045729, RRID:AB_10963430 | TSKS antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable | polyclonal | AB_10963430 | Sigma-Aldrich | HPA045729 | 2025-08-19 07:16:45 | 0 | |||
|
Anti-C9orf78 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA021242, RRID:AB_1845838 | C9orf78 antibody produced in rabbit | human | Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Immunohistochemistry; Other; Western Blot | polyclonal | rabbit | AB_1845838 | Sigma-Aldrich | HPA021242 | 2025-08-19 07:16:30 | 0 | ||
|
Phospho-Histone H3 (Ser10) Antibody Resource Report Resource Website 100+ mentions Rating or validation data |
Cell Signaling Technology Cat# 9701, RRID:AB_331535 | Phospho-Histone H3 (Ser10) | Human, Rat, Monkey, Mouse, D. melanogaster, S. cerevisiae | Applications: W, IHC-P, IHC-F, IF-IC, F. Consolidation: AB_331534. | polyclonal | rabbit | AB_331535 | Cell Signaling Technology | 9701 (also 9701S, 9701L) | 2025-08-19 07:11:35 | 173 | ||
|
Anti-CCDC134 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA003936, RRID:AB_1078419 | CCDC134 antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_1078419 | Sigma-Aldrich | HPA003936 | 2025-08-19 07:11:52 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.
Email: info_at_ dknet.org
