Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10959746
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable
Clonality: polyclonal
Target(s): SH3D21 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA042456, RRID:AB_10959746 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2104099
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FHDC1
Proper citation: Atlas Antibodies Cat# HPA008527, RRID:AB_2104099 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10796227
Comments: Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): RNH1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA040781, RRID:AB_10796227 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1604287
Comments: Applications: WB, IP, IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): SAM68
Proper citation: Bethyl Cat# A302-110A, RRID:AB_1604287 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682756
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SPN
Proper citation: Atlas Antibodies Cat# HPA055244, RRID:AB_2682756 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10959613
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Clonality: polyclonal
Target(s): WDR43 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA044733, RRID:AB_10959613 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10964127
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Clonality: polyclonal
Target(s): HS2ST1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA043069, RRID:AB_10964127 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845577
Comments: Vendor recommendations: Other; Western Blot; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): NPRL3 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA011741, RRID:AB_1845577 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601928
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MGDLELLLPGEAEVLVRGLRSFPLREMGSEGWNQQHENLEKLNMQAILDATVSQGEPIQELLVTHGKVPTLVEELIAVEMWKQKVFPVFCRVEDFKPQNT; Manufacturer approved use: ICC-IF, IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZMYND10
Proper citation: Atlas Antibodies Cat# HPA035255, RRID:AB_10601928 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10797146
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): LEPREL2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA043695, RRID:AB_10797146 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2196323
Comments: Applications: WB, IP
Host Organism: rabbit
Clonality: polyclonal
Target(s): SRC1
Proper citation: Bethyl Cat# A300-344A, RRID:AB_2196323 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845509
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human BZRAP1
Proper citation: Sigma-Aldrich Cat# HPA025244, RRID:AB_1845509 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845601
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): C17orf70 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA023954, RRID:AB_1845601 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1950159
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 39812 for K562; status is awaiting lab characterization
Host Organism: rabbit
Clonality: polyclonal
Target(s): E2F1
Proper citation: GeneTex Cat# GTX101235, RRID:AB_1950159 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10960842
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Clonality: polyclonal
Target(s): AC117834.1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA045111, RRID:AB_10960842 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847200
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): CPSF2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA024238, RRID:AB_1847200 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10963430
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Clonality: polyclonal
Target(s): TSKS antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA045729, RRID:AB_10963430 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845838
Comments: Vendor recommendations: indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunofluorescence; Immunohistochemistry; Other; Western Blot
Host Organism: rabbit
Clonality: polyclonal
Target(s): C9orf78 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA021242, RRID:AB_1845838 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_331535
Comments: Applications: W, IHC-P, IHC-F, IF-IC, F. Consolidation: AB_331534.
Host Organism: rabbit
Clonality: polyclonal
Target(s): Phospho-Histone H3 (Ser10)
Proper citation: Cell Signaling Technology Cat# 9701, RRID:AB_331535 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078419
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): CCDC134 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA003936, RRID:AB_1078419 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.