Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2103395
Comments: Applications: Flow Cytometry, Immunohistochemistry, Neutralization, CyTOF-ready
Host Organism: Mouse
Clonality: monoclonal
Target(s): FGFR2
Proper citation: R and D Systems Cat# MAB6843, RRID:AB_2103395 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601017
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GPATCH4
Proper citation: Atlas Antibodies Cat# HPA028323, RRID:AB_10601017 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_11203199
Comments: Applications: WB, IP
Original Manufacturer
Host Organism: rabbit
Clonality: polyclonal
Target(s): CDC40
Proper citation: Bethyl Cat# A303-699A, RRID:AB_11203199 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10671706
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): UGDH
Proper citation: Atlas Antibodies Cat# HPA036656, RRID:AB_10671706 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683710
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GAD1
Proper citation: Atlas Antibodies Cat# HPA058412, RRID:AB_2683710 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852892
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CNTROB
Proper citation: Atlas Antibodies Cat# HPA023325, RRID:AB_1852892 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679974
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): NAT14
Proper citation: Atlas Antibodies Cat# HPA047187, RRID:AB_2679974 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682065
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): OR6B1
Proper citation: Atlas Antibodies Cat# HPA053164, RRID:AB_2682065 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794162
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): SPACA4
Proper citation: Atlas Antibodies Cat# HPA041927, RRID:AB_10794162 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683691
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): WNT9B
Proper citation: Atlas Antibodies Cat# HPA058361, RRID:AB_2683691 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10952225
Comments: Discontinued; Applications: IHC (1:500-1:2,000), IP (2-10 µg/mg lysate), WB (1:2,000-1:10,000)
Host Organism: rabbit
Clonality: polyclonal
Target(s): LEF1
Proper citation: Thermo Fisher Scientific Cat# A303-487A, RRID:AB_10952225 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_150606
Comments: Used By NYUIHC-75
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:TRUE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality: unknown
Target(s): Beta galactosidase from E.coli
Proper citation: Meridian Life Science Cat# B59136R, RRID:AB_150606 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2615331
Comments: Applications: IP
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF184
Proper citation: Bethyl Cat# A303-739A, RRID:AB_2615331 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616139
Comments: ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality: unknown
Target(s): Trl
Proper citation: Kevin White Cat# Aviva-KW3-Trl-D2, RRID:AB_2616139 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2616527
Comments: ENCODE PROJECT External validation DATA SET is released testing lot unknown for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality: unknown
Target(s): su(Hw)
Proper citation: Vincenzo Pirrotta Cat# non-commercial su(Hw) modENCODE antibody 1, RRID:AB_2616527 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685525
Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ORMDL1
Proper citation: Atlas Antibodies Cat# HPA065643, RRID:AB_2685525 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2672554
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SYNC
Proper citation: Atlas Antibodies Cat# HPA028311, RRID:AB_2672554 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794078
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): IZUMO2
Proper citation: Atlas Antibodies Cat# HPA042143, RRID:AB_10794078 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685484
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SIVA1
Proper citation: Atlas Antibodies Cat# HPA065398, RRID:AB_2685484 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685811
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDS; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): NCR2
Proper citation: Atlas Antibodies Cat# HPA067249, RRID:AB_2685811 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.