Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 210 showing 4181 ~ 4200 out of 55,392 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection
  • RRID:AB_2685484

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2685484

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SIVA1

Proper citation: Atlas Antibodies Cat# HPA065398, RRID:AB_2685484 Copy   


  • RRID:AB_2685811

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2685811

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDS; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): NCR2

Proper citation: Atlas Antibodies Cat# HPA067249, RRID:AB_2685811 Copy   


  • RRID:AB_2685954

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2685954

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ANKH

Proper citation: Atlas Antibodies Cat# HPA068104, RRID:AB_2685954 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686162

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CEACAM7

Proper citation: Atlas Antibodies Cat# HPA069621, RRID:AB_2686162 Copy   


  • RRID:AB_2680479

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2680479

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CBX6

Proper citation: Atlas Antibodies Cat# HPA048653, RRID:AB_2680479 Copy   


  • RRID:AB_10795635

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10795635

Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): TFAM antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA040648, RRID:AB_10795635 Copy   


  • RRID:AB_2686158

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686158

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GRPR

Proper citation: Atlas Antibodies Cat# HPA069604, RRID:AB_2686158 Copy   


  • RRID:AB_2677961

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2677961

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MC5R

Proper citation: Atlas Antibodies Cat# HPA042365, RRID:AB_2677961 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2668214

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ATP7B

Proper citation: Atlas Antibodies Cat# HPA009137, RRID:AB_2668214 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2683267

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF444

Proper citation: Atlas Antibodies Cat# HPA056895, RRID:AB_2683267 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2682784

Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ATP6V0D2

Proper citation: Atlas Antibodies Cat# HPA055327, RRID:AB_2682784 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2682525

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TRIM52

Proper citation: Atlas Antibodies Cat# HPA054565, RRID:AB_2682525 Copy   


  • RRID:AB_2732404

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2732404

Host Organism: rabbit
Clonality: unknown
Target(s): IGSF1

Proper citation: Sigma-Aldrich Cat# HPA012732, RRID:AB_2732404 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2241243

Comments: Useful for immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): TTC25

Proper citation: Sigma-Aldrich Cat# HPA023908, RRID:AB_2241243 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1852395

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): KIAA1267 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA007208, RRID:AB_1852395 Copy   


  • RRID:AB_2684180

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2684180

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GRHL3

Proper citation: Atlas Antibodies Cat# HPA059960, RRID:AB_2684180 Copy   


  • RRID:AB_1859392

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1859392

Comments: ENCODE PROJECT External validation DATA SET is released testing lot QC1277 for any cell type or tissues; status is awaiting lab characterization
Host Organism: rabbit
Clonality: unknown
Target(s): ZNF652

Proper citation: Sigma-Aldrich Cat# AV31678, RRID:AB_1859392 Copy   


  • RRID:AB_1857409

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1857409

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): UAP1

Proper citation: Atlas Antibodies Cat# HPA014659, RRID:AB_1857409 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_330232

Comments: Applications: W. Consolidation on 11/2018: AB_10078266, AB_10104698, AB_2262427, AB_2314224, AB_330232. Info: Used By NYUIHC-1083.
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality: polyclonal
Target(s): Phospho-Ezrin (Thr567)/Radixin (Thr564)/Moesin (Thr558)

Proper citation: Cell Signaling Technology Cat# 3141, RRID:AB_330232 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1857160

Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human SLC41A1

Proper citation: Sigma-Aldrich Cat# HPA015138, RRID:AB_1857160 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within dkNET that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X