Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-CCDC21 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA028252, RRID:AB_1846142 CCDC21 antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other; Western Blot polyclonal rabbit AB_1846142 Sigma-Aldrich HPA028252 2025-08-19 07:15:53 0
Anti-ABCC1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA002380, RRID:AB_1844432 Human ABCC1 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1844432 Sigma-Aldrich HPA002380 2025-08-19 07:16:05 0
Anti-ASAH1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA005468, RRID:AB_1845062 Human ASAH1 human Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1845062 Sigma-Aldrich HPA005468 2025-08-19 07:19:44 0
Anti-KBTBD7 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA043709, RRID:AB_10961260 KBTBD7 antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable polyclonal AB_10961260 Sigma-Aldrich HPA043709 2025-08-19 07:19:45 0
Anti-DHRS3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA010844, RRID:AB_1847653 DHRS3 rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1847653 Atlas Antibodies HPA010844 2025-08-19 07:20:02 0
ADAMTS-18
 
Resource Report
Resource Website
Rating or validation data
New York University; New York; USA Cat# SK0001, RRID:AB_2335838 ND Used By NYUIHC-543
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
unknown rabbit AB_2335838 New York University; New York; USA SK0001 2025-08-19 07:20:02 0
Anti-RFX3 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA035689, RRID:AB_10671224 RFX3 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10671224 Atlas Antibodies HPA035689 2025-08-19 07:20:13 3
Anti-GRSF1 antibody produced in rabbit
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Sigma-Aldrich Cat# HPA036985, RRID:AB_10672785 GRSF1 antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry polyclonal rabbit AB_10672785 Sigma-Aldrich HPA036985 2025-08-19 07:20:13 1
Anti-NSMCE4A antibody produced in rabbit
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Sigma-Aldrich Cat# HPA037459, RRID:AB_10696932 NSMCE4A antibody produced in rabbit human Vendor recommendations: Other; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_10696932 Sigma-Aldrich HPA037459 2025-08-19 07:20:14 1
Anti-TEX9
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA039415, RRID:AB_10672775 TEX9 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10672775 Atlas Antibodies HPA039415 2025-08-19 07:20:24 0
Anti-WDTC1
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA028177, RRID:AB_10600419 WDTC1 human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10600419 Atlas Antibodies HPA028177 2025-08-19 07:20:23 0
Anti-BTLA polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA047211, RRID:AB_2679983 BTLA human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRP; Manufacturer approved use: IHC polyclonal rabbit AB_2679983 Atlas Antibodies HPA047211 2025-08-19 07:20:28 0
Anti-CMTM5
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA052338, RRID:AB_2681793 CMTM5 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2681793 Atlas Antibodies HPA052338 2025-08-19 07:20:24 0
Anti-BTBD11 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA055898, RRID:AB_2682964 BTBD11 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2682964 Atlas Antibodies HPA055898 2025-08-19 07:20:24 0
Anti-MAP1LC3A polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA052484, RRID:AB_2681846 MAP1LC3A human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681846 Atlas Antibodies HPA052484 2025-08-19 07:20:28 0
Anti-EEF1A1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA056990, RRID:AB_2683302 EEF1A1 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683302 Atlas Antibodies HPA056990 2025-08-19 07:20:28 0
Anti-POLR2J polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA046970, RRID:AB_2679882 POLR2J human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2679882 Atlas Antibodies HPA046970 2025-08-19 07:20:24 0
Anti-GCG
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA036760, RRID:AB_2675296 GCG human Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2675296 Atlas Antibodies HPA036760 2025-08-19 07:20:27 0
Anti-HNRNPUL1
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Sigma-Aldrich Cat# HPA046290, RRID:AB_2679616 HNRNPUL1 human unknown rabbit AB_2679616 Sigma-Aldrich HPA046290 2025-08-19 07:20:25 1
Anti-PES1
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA062439, RRID:AB_2684764 PES1 human unknown rabbit AB_2684764 Sigma-Aldrich HPA062439 2025-08-19 07:20:30 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.