Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846142
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other; Western Blot
Host Organism: rabbit
Clonality: polyclonal
Target(s): CCDC21 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA028252, RRID:AB_1846142 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1844432
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human ABCC1
Proper citation: Sigma-Aldrich Cat# HPA002380, RRID:AB_1844432 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845062
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human ASAH1
Proper citation: Sigma-Aldrich Cat# HPA005468, RRID:AB_1845062 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10961260
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Clonality: polyclonal
Target(s): KBTBD7 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA043709, RRID:AB_10961260 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847653
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): DHRS3
Proper citation: Atlas Antibodies Cat# HPA010844, RRID:AB_1847653 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2335838
Comments: Used By NYUIHC-543
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: rabbit
Clonality: unknown
Target(s): ND
Proper citation: New York University; New York; USA Cat# SK0001, RRID:AB_2335838 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10671224
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RFX3
Proper citation: Atlas Antibodies Cat# HPA035689, RRID:AB_10671224 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672785
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): GRSF1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA036985, RRID:AB_10672785 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10696932
Comments: Vendor recommendations: Other; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): NSMCE4A antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA037459, RRID:AB_10696932 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672775
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): TEX9
Proper citation: Atlas Antibodies Cat# HPA039415, RRID:AB_10672775 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600419
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): WDTC1
Proper citation: Atlas Antibodies Cat# HPA028177, RRID:AB_10600419 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679983
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRP; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): BTLA
Proper citation: Atlas Antibodies Cat# HPA047211, RRID:AB_2679983 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681793
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): CMTM5
Proper citation: Atlas Antibodies Cat# HPA052338, RRID:AB_2681793 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682964
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): BTBD11
Proper citation: Atlas Antibodies Cat# HPA055898, RRID:AB_2682964 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681846
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MAP1LC3A
Proper citation: Atlas Antibodies Cat# HPA052484, RRID:AB_2681846 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683302
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): EEF1A1
Proper citation: Atlas Antibodies Cat# HPA056990, RRID:AB_2683302 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679882
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): POLR2J
Proper citation: Atlas Antibodies Cat# HPA046970, RRID:AB_2679882 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2675296
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): GCG
Proper citation: Atlas Antibodies Cat# HPA036760, RRID:AB_2675296 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679616
Host Organism: rabbit
Clonality: unknown
Target(s): HNRNPUL1
Proper citation: Sigma-Aldrich Cat# HPA046290, RRID:AB_2679616 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684764
Host Organism: rabbit
Clonality: unknown
Target(s): PES1
Proper citation: Sigma-Aldrich Cat# HPA062439, RRID:AB_2684764 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.