Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 204 showing 4061 ~ 4080 out of 55,392 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2686389

Comments: Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KLHL12

Proper citation: Atlas Antibodies Cat# HPA071324, RRID:AB_2686389 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2683091

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): MMS19

Proper citation: Atlas Antibodies Cat# HPA056299, RRID:AB_2683091 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2683851

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PALM2-AKAP2

Proper citation: Atlas Antibodies Cat# HPA058905, RRID:AB_2683851 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10601030

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF189

Proper citation: Atlas Antibodies Cat# HPA034814, RRID:AB_10601030 Copy   


  • RRID:AB_2683409

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2683409

Host Organism: rabbit
Clonality: unknown
Target(s): ATP6V1D

Proper citation: Sigma-Aldrich Cat# HPA057316, RRID:AB_2683409 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2680953

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SPATA45

Proper citation: Atlas Antibodies Cat# HPA049921, RRID:AB_2680953 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2685237

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PRRC2B

Proper citation: Atlas Antibodies Cat# HPA064301, RRID:AB_2685237 Copy   


  • RRID:AB_2681701

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2681701

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRF; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): WNT6

Proper citation: Atlas Antibodies Cat# HPA052031, RRID:AB_2681701 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2615878

Comments: manufacturer recommendations: IgG WB(1:100-500), ELISA(1:500-1000), IP(1:20-100), IHC-P(1:100-500), IHC-F(1:100-500), Flow-Cyt(1:20-100), IF(1:50-200); Western Blot; ELISA; Flow Cytometry; Immunohistochemistry; Immunoprecipitation; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_10855094, AB_2615878.
Host Organism: rabbit
Clonality: polyclonal
Target(s): Rabbit HDAC11

Proper citation: Bioss Cat# bs-2894R, RRID:AB_2615878 Copy   


  • RRID:AB_640607

    This resource has 1+ mentions.

Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_640607

Comments: Discontinued: 2016; validation status unknown check with seller; recommendations: ELISA; Immunofluorescence; Immunoprecipitation; Western Blot; Western Blotting, Immunoprecipitation, Immunofluorescence, ELISA
Host Organism: rabbit
Clonality: polyclonal
Target(s): FOXO1

Proper citation: Santa Cruz Biotechnology Cat# sc-11350, RRID:AB_640607 Copy   


  • RRID:AB_2037593

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2037593

Comments: ENCODE PROJECT External validation DATA SET is released testing lot 39742 for not specified; status is not pursued
Host Organism: rabbit
Clonality: polyclonal
Target(s): PABPN1

Proper citation: GeneTex Cat# GTX101490, RRID:AB_2037593 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10964133

Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable
Clonality: polyclonal
Target(s): NINJ1 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA045063, RRID:AB_10964133 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1078595

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): CXorf36 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA002806, RRID:AB_1078595 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2213805

Comments: Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): URB2 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA008902, RRID:AB_2213805 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10671506

Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): GTPBP8 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA034831, RRID:AB_10671506 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10670380

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): BOD1L antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA037362, RRID:AB_10670380 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10598915

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SASH1

Proper citation: Atlas Antibodies Cat# HPA029947, RRID:AB_10598915 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1859189

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF318

Proper citation: Atlas Antibodies Cat# HPA027022, RRID:AB_1859189 Copy   


  • RRID:AB_10602151

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10602151

Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): RABIF

Proper citation: Atlas Antibodies Cat# HPA027715, RRID:AB_10602151 Copy   


  • RRID:AB_10793973

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10793973

Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CLC

Proper citation: Atlas Antibodies Cat# HPA041751, RRID:AB_10793973 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within dkNET that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X