Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-CSNK1G2
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA034868, RRID:AB_10671235 CSNK1G2 human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10671235 Atlas Antibodies HPA034868 2025-08-19 07:59:53 0
Anti-THEMIS2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA031097, RRID:AB_10601882 THEMIS2 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10601882 Atlas Antibodies HPA031097 2025-08-19 08:00:08 0
Anti-PCBD1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA061723, RRID:AB_2684594 PCBD1 human Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2684594 Atlas Antibodies HPA061723 2025-08-19 08:00:11 0
Anti-TAF8
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA031731, RRID:AB_2674017 TAF8 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2674017 Atlas Antibodies HPA031731 2025-08-19 08:00:09 0
Anti-TMEM176A
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA008770, RRID:AB_2256120 TMEM176A human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2256120 Atlas Antibodies HPA008770 2025-08-19 08:00:08 1
Anti-ZNF852 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA049885, RRID:AB_2680933 ZNF852 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680933 Atlas Antibodies HPA049885 2025-08-19 08:00:10 0
Anti-ACOX2
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA038280, RRID:AB_10672623 ACOX2 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10672623 Atlas Antibodies HPA038280 2025-08-19 08:00:09 0
Anti-ZFP36L1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA001301, RRID:AB_1080644 ZFP36L1 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PRCHFIHNAEERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGSPTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLSDQEGYLSSSSSSHSGSDSPT; Manufacturer approved use: IHC polyclonal rabbit AB_1080644 Atlas Antibodies HPA001301 2025-08-19 07:59:53 0
Histone H3 [ac Lys36] Antibody
 
Resource Report
Resource Website
Rating or validation data
Novus Cat# NB21-1254, RRID:AB_10804910 Histone H3 Human, C. elegans, Mouse Applications: Western Blot, Dot Blot polyclonal Rabbit AB_10804910 Novus NB21-1254 (also NB21-1254SS) 2025-08-19 08:00:12 0
Anti-TBL3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA042562, RRID:AB_10964911 TBL3 rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10964911 Atlas Antibodies HPA042562 2025-08-19 08:07:37 0
Anti-ARG2 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA000663, RRID:AB_1078192 Human ARG2 human Vendor recommendations: unknown rabbit AB_1078192 Sigma-Aldrich HPA000663 2025-08-19 08:07:45 0
Rabbit anti-BCCIP Antibody, Affinity Purified
 
Resource Report
Resource Website
Discontinued
Rating or validation data
Bethyl Cat# A302-196A, RRID:AB_1659789 BCCIP human Applications: WB, IP
Original Manufacturer
polyclonal rabbit AB_1659789 Bethyl A302-196A (also A302-196A-T, A302-196A-M) 2025-08-19 08:07:50 0
Tyrosinase Related Protein-2
 
Resource Report
Resource Website
Discontinued
Rating or validation data
Santa Cruz Biotechnology Cat# sc-10452, RRID:AB_11150299 Rasied against a peptide mapping near the c-terminus of TRP-2 of human origin. Discontinued: 2016; Used By NYUIHC-598
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
unknown goat AB_11150299 Santa Cruz Biotechnology sc-10452 2025-08-19 08:07:46 0
Goat Anti-ADAMTS-18 Polyclonal Antibody, Unconjugated
 
Resource Report
Resource Website
Discontinued
Rating or validation data
Santa Cruz Biotechnology Cat# sc-67707, RRID:AB_2222168 Adamts18 rat, mouse, human Discontinued: 2016; validation status unknown check with seller; recommendations: western blot, ELISA, immunocytochemistry
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
polyclonal goat AB_2222168 Santa Cruz Biotechnology sc-67707 2025-08-19 08:07:52 0
IGF2BP1-human
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Cell Signaling Technology Cat# 8482, RRID:AB_11179079 IGF2BP1 homo sapiens ENCODE PROJECT External validation DATA SET is released testing lot 1 for K562; status is awaiting lab characterization monoclonal rabbit AB_11179079 Cell Signaling Technology 8482 2025-08-19 08:07:47 9
Human CXCL9/MIG Antibody
 
Resource Report
Resource Website
Rating or validation data
R and D Systems Cat# AF392, RRID:AB_355342 CXCL9/MIG Human Applications: Western Blot, Neutralization, Immunocytochemistry polyclonal Goat AB_355342 R and D Systems AF392 (also AF392-SP) 2025-08-19 08:00:57 0
Anti-MAP4K3 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA030380, RRID:AB_10601132 MAP4K3 antibody produced in rabbit human Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal rabbit AB_10601132 Sigma-Aldrich HPA030380 2025-08-19 09:12:42 0
Anti-C4orf14 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA035839, RRID:AB_10669658 C4orf14 antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Other polyclonal rabbit AB_10669658 Sigma-Aldrich HPA035839 2025-08-19 09:12:46 0
Anti-AHCTF1 antibody produced in rabbit
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Sigma-Aldrich Cat# HPA031658, RRID:AB_10601968 AHCTF1 antibody produced in rabbit human Vendor recommendations: Other; Immunohistochemistry; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal rabbit AB_10601968 Sigma-Aldrich HPA031658 2025-08-19 09:12:42 1
ZNF622-human
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# SAB1401933, RRID:AB_10608043 ZNF622 Homo sapiens ENCODE PROJECT External validation DATA SET is released testing lot 09282-4G6 for not specified; status is not pursued monoclonal mouse AB_10608043 Sigma-Aldrich SAB1401933 2025-08-19 09:12:40 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.