Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
IGF2BP1-human Resource Report Resource Website 1+ mentions Rating or validation data |
Cell Signaling Technology Cat# 8482, RRID:AB_11179079 | IGF2BP1 | homo sapiens | ENCODE PROJECT External validation DATA SET is released testing lot 1 for K562; status is awaiting lab characterization | monoclonal | rabbit | AB_11179079 | Cell Signaling Technology | 8482 | 2025-08-19 08:07:47 | 9 | ||
|
Anti-MTCH1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA015971, RRID:AB_1854171 | MTCH1 antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_1854171 | Sigma-Aldrich | HPA015971 | 2025-08-19 08:07:57 | 0 | ||
|
Anti-Ki-67 Resource Report Resource Website 10+ mentions Rating or validation data |
Millipore Cat# AB9260, RRID:AB_2142366 | Ki-67 | rat, mouse, human | Applications: IHC(P) & WB. The following antibodies were determined to be duplicates and consolidated by curator on 10/2018: AB_2142366, AB_10141019, AB_11214025. | polyclonal | rabbit | AB_2142366 | Millipore | AB9260 | 2025-08-19 08:08:00 | 43 | ||
|
Anti-C12orf43 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA046148, RRID:AB_10965169 | C12orf43 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable | polyclonal | AB_10965169 | Sigma-Aldrich | HPA046148 | 2025-08-19 08:08:07 | 0 | |||
|
Anti-SBK2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA030631, RRID:AB_10602088 | SBK2 antibody produced in rabbit | human | Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_10602088 | Sigma-Aldrich | HPA030631 | 2025-08-19 08:08:21 | 0 | ||
|
Anti-PGF antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA041624, RRID:AB_10794522 | PGF antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_10794522 | Sigma-Aldrich | HPA041624 | 2025-08-19 08:08:16 | 0 | ||
|
Anti-MUC1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA004179, RRID:AB_1846282 | MUC1 antibody produced in rabbit | human | Vendor recommendations: Immunofluorescence; Other; Immunohistochemistry; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable | polyclonal | rabbit | AB_1846282 | Sigma-Aldrich | HPA004179 | 2025-08-19 07:55:14 | 0 | ||
|
Anti-UPK1B antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA031799, RRID:AB_10671579 | UPK1B antibody produced in rabbit | human | Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_10671579 | Sigma-Aldrich | HPA031799 | 2025-08-19 07:54:46 | 0 | ||
|
Anti-TGFBRAP1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA038397, RRID:AB_10669782 | TGFBRAP1 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry | polyclonal | rabbit | AB_10669782 | Sigma-Aldrich | HPA038397 | 2025-08-19 07:55:18 | 0 | ||
|
Anti-RNASEH2B antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA040084, RRID:AB_10697714 | RNASEH2B antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry | polyclonal | rabbit | AB_10697714 | Sigma-Aldrich | HPA040084 | 2025-08-19 07:54:46 | 0 | ||
|
Anti-IL13 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA042421, RRID:AB_10795504 | IL13 antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_10795504 | Sigma-Aldrich | HPA042421 | 2025-08-19 07:55:23 | 0 | ||
|
Rabbit Anti-Human INE1 Antibody, Unconjugated Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA003212, RRID:AB_1079140 | Human INE1 | human | Vendor recommendations: | unknown | rabbit | AB_1079140 | Sigma-Aldrich | HPA003212 | 2025-08-19 07:55:23 | 0 | ||
|
Anti-WWTR1 antibody produced in rabbit Resource Report Resource Website 10+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA007415, RRID:AB_1080602 | Human WWTR1 | human | Vendor recommendations: | unknown | rabbit | AB_1080602 | Sigma-Aldrich | HPA007415 | 2025-08-19 07:54:54 | 18 | ||
|
Anti-FAM40B antibody produced in rabbit Resource Report Resource Website 1+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA019657, RRID:AB_1848399 | FAM40B antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry | polyclonal | rabbit | AB_1848399 | Sigma-Aldrich | HPA019657 | 2025-08-19 07:55:04 | 1 | ||
|
Anti-CCDC155 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA019940, RRID:AB_1848879 | CCDC155 antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_1848879 | Sigma-Aldrich | HPA019940 | 2025-08-19 07:55:31 | 0 | ||
|
Anti-TTC31 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA041783, RRID:AB_10794306 | TTC31 antibody produced in rabbit | human | Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_10794306 | Sigma-Aldrich | HPA041783 | 2025-08-19 07:55:04 | 0 | ||
|
IL-17 (H-132) Resource Report Resource Website 1+ mentions Discontinued Rating or validation data |
Santa Cruz Biotechnology Cat# sc-7927, RRID:AB_2124997 | IL-17 (H-132) | rat, porcine, mouse, human | Discontinued: 2016; validation status unknown check with seller; recommendations: ELISA; Immunoprecipitation; WB, IP, IF, IHC(P), ELISA; Immunofluorescence; Immunocytochemistry; Western Blot | polyclonal | rabbit | AB_2124997 | Santa Cruz Biotechnology | sc-7927 | 2025-08-19 08:03:10 | 3 | ||
|
HNRNPC-human Resource Report Resource Website 1+ mentions Discontinued Rating or validation data |
Santa Cruz Biotechnology Cat# sc-10037, RRID:AB_2117316 | HNRNPC | homo sapiens | N-16 | Discontinued: 2016; ENCODE PROJECT External validation DATA SET is released testing lot E0912 for K562,HepG2; status is awaiting lab characterization | polyclonal | goat | AB_2117316 | Santa Cruz Biotechnology | sc-10037 | 2025-08-19 08:03:10 | 1 | |
|
Anti-AC006449.2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA023912, RRID:AB_2671360 | AC006449.2 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EGRSVLGGVSWFQCTESLGPLTLQHGNLGVDLLLFPSRQKLSFALSGPALGKGVGVNEQLF; Manufacturer approved use: IHC | polyclonal | rabbit | AB_2671360 | Atlas Antibodies | HPA023912 | 2025-08-19 08:03:35 | 0 | ||
|
Anti-IL17RB polyclonal antibody Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA005482, RRID:AB_1234567 | IL17RB | human | PMID:26644354 | Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1234567 | Atlas Antibodies | HPA005482 | 2025-08-19 08:03:35 | 1 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.