Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 199 showing 3961 ~ 3980 out of 55,392 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection
  • RRID:AB_11179079

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_11179079

Comments: ENCODE PROJECT External validation DATA SET is released testing lot 1 for K562; status is awaiting lab characterization
Host Organism: rabbit
Clonality: monoclonal
Target(s): IGF2BP1

Proper citation: Cell Signaling Technology Cat# 8482, RRID:AB_11179079 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1854171

Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): MTCH1 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA015971, RRID:AB_1854171 Copy   


  • RRID:AB_2142366

    This resource has 10+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2142366

Comments: Applications: IHC(P) & WB. The following antibodies were determined to be duplicates and consolidated by curator on 10/2018: AB_2142366, AB_10141019, AB_11214025.
Host Organism: rabbit
Clonality: polyclonal
Target(s): Ki-67

Proper citation: Millipore Cat# AB9260, RRID:AB_2142366 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10965169

Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable
Clonality: polyclonal
Target(s): C12orf43 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA046148, RRID:AB_10965169 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10602088

Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): SBK2 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA030631, RRID:AB_10602088 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10794522

Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): PGF antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA041624, RRID:AB_10794522 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1846282

Comments: Vendor recommendations: Immunofluorescence; Other; Immunohistochemistry; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): MUC1 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA004179, RRID:AB_1846282 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10671579

Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): UPK1B antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA031799, RRID:AB_10671579 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10669782

Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): TGFBRAP1 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA038397, RRID:AB_10669782 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10697714

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): RNASEH2B antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA040084, RRID:AB_10697714 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10795504

Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): IL13 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA042421, RRID:AB_10795504 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1079140

Comments: Vendor recommendations:
Host Organism: rabbit
Clonality: unknown
Target(s): Human INE1

Proper citation: Sigma-Aldrich Cat# HPA003212, RRID:AB_1079140 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1080602

Comments: Vendor recommendations:
Host Organism: rabbit
Clonality: unknown
Target(s): Human WWTR1

Proper citation: Sigma-Aldrich Cat# HPA007415, RRID:AB_1080602 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1848399

Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): FAM40B antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA019657, RRID:AB_1848399 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1848879

Comments: Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): CCDC155 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA019940, RRID:AB_1848879 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10794306

Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): TTC31 antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# HPA041783, RRID:AB_10794306 Copy   


  • RRID:AB_2124997

    This resource has 1+ mentions.

Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2124997

Comments: Discontinued: 2016; validation status unknown check with seller; recommendations: ELISA; Immunoprecipitation; WB, IP, IF, IHC(P), ELISA; Immunofluorescence; Immunocytochemistry; Western Blot
Host Organism: rabbit
Clonality: polyclonal
Target(s): IL-17 (H-132)

Proper citation: Santa Cruz Biotechnology Cat# sc-7927, RRID:AB_2124997 Copy   


  • RRID:AB_2117316

    This resource has 1+ mentions.

Discontinued

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2117316

Comments: Discontinued: 2016; ENCODE PROJECT External validation DATA SET is released testing lot E0912 for K562,HepG2; status is awaiting lab characterization
Host Organism: goat
Clonality: polyclonal
Target(s): HNRNPC

Proper citation: Santa Cruz Biotechnology Cat# sc-10037, RRID:AB_2117316 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2671360

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EGRSVLGGVSWFQCTESLGPLTLQHGNLGVDLLLFPSRQKLSFALSGPALGKGVGVNEQLF; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): AC006449.2

Proper citation: Atlas Antibodies Cat# HPA023912, RRID:AB_2671360 Copy   


  • RRID:AB_1234567

    This resource has 1+ mentions.

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1234567

Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): IL17RB

Proper citation: Atlas Antibodies Cat# HPA005482, RRID:AB_1234567 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within dkNET that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X