Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
| Antibody Name | Proper Citation | Target Antigen | Target Organism |
Clone ID |
Defining Citation |
Comments |
|||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
Anti-PLA2G4C antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA043083, RRID:AB_10795714 | PLA2G4C antibody produced in rabbit | human | Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | rabbit | AB_10795714 | Sigma-Aldrich | HPA043083 | 2025-08-19 07:40:01 | 0 | ||
|
Anti-NRK antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA017238, RRID:AB_1854645 | Human NRK | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1854645 | Sigma-Aldrich | HPA017238 | 2025-08-19 07:40:11 | 0 | ||
|
Anti-MTERF antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA044894, RRID:AB_10966284 | MTERF antibody produced in rabbit | human | Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable | polyclonal | AB_10966284 | Sigma-Aldrich | HPA044894 | 2025-08-19 07:40:44 | 0 | |||
|
Anti-HS2ST1 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA043603, RRID:AB_10963432 | HS2ST1 antibody produced in rabbit | human | Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable | polyclonal | AB_10963432 | Sigma-Aldrich | HPA043603 | 2025-08-19 07:40:44 | 0 | |||
|
Anti-USP10 Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA006731, RRID:AB_1080495 | USP10 | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | unknown | rabbit | AB_1080495 | Atlas Antibodies | HPA006731 | 2025-08-19 07:40:55 | 2 | ||
|
Rabbit anti-SUPT5H Antibody, Affinity Purified Resource Report Resource Website 1+ mentions Discontinued Rating or validation data |
Bethyl Cat# A300-869A, RRID:AB_609484 | SUPT5H | human |
Applications: WB, IP, IHC Original Manufacturer |
polyclonal | rabbit | AB_609484 | Bethyl | A300-869A (also A300-869A-T, A300-869A-M) | 2025-08-19 07:40:59 | 1 | ||
|
Anti-RAP1GAP2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA022148, RRID:AB_1849474 | Human GARNL4 | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1849474 | Sigma-Aldrich | HPA022148 | 2025-08-19 07:41:00 | 0 | ||
|
Anti-PPID antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA019692, RRID:AB_1847401 | Human PPID | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1847401 | Sigma-Aldrich | HPA019692 | 2025-08-19 07:41:04 | 0 | ||
|
Anti-SLC27A4 antibody produced in rabbit Resource Report Resource Website 1+ mentions Rating or validation data |
Sigma-Aldrich Cat# HPA007293, RRID:AB_1857062 | Human SLC27A4 | human | Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1857062 | Sigma-Aldrich | HPA007293 | 2025-08-19 07:41:22 | 1 | ||
|
Anti-CASP6 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA011337, RRID:AB_1846053 | Human CASP6 | human | Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1846053 | Sigma-Aldrich | HPA011337 | 2025-08-19 07:41:04 | 0 | ||
|
Anti-SLIT2 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA023088, RRID:AB_1857227 | Human SLIT2 | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1857227 | Sigma-Aldrich | HPA023088 | 2025-08-19 07:41:05 | 0 | ||
|
Anti-PPP1R15A antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA020240, RRID:AB_1849404 | Human PPP1R15A | human | Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array | unknown | rabbit | AB_1849404 | Sigma-Aldrich | HPA020240 | 2025-08-19 07:41:21 | 0 | ||
|
Anti-LNPK Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA014205, RRID:AB_2234186 | LNPK | human | Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_2234186 | Atlas Antibodies | HPA014205 | 2025-08-19 07:41:20 | 1 | ||
|
IL-17 (H-132) Resource Report Resource Website 1+ mentions Discontinued Rating or validation data |
Santa Cruz Biotechnology Cat# sc-7927, RRID:AB_2124997 | IL-17 (H-132) | rat, porcine, mouse, human | Discontinued: 2016; validation status unknown check with seller; recommendations: ELISA; Immunoprecipitation; WB, IP, IF, IHC(P), ELISA; Immunofluorescence; Immunocytochemistry; Western Blot | polyclonal | rabbit | AB_2124997 | Santa Cruz Biotechnology | sc-7927 | 2025-08-19 08:03:10 | 3 | ||
|
HNRNPC-human Resource Report Resource Website 1+ mentions Discontinued Rating or validation data |
Santa Cruz Biotechnology Cat# sc-10037, RRID:AB_2117316 | HNRNPC | homo sapiens | N-16 | Discontinued: 2016; ENCODE PROJECT External validation DATA SET is released testing lot E0912 for K562,HepG2; status is awaiting lab characterization | polyclonal | goat | AB_2117316 | Santa Cruz Biotechnology | sc-10037 | 2025-08-19 08:03:10 | 1 | |
|
Anti-AC006449.2 polyclonal antibody Resource Report Resource Website Rating or validation data |
Atlas Antibodies Cat# HPA023912, RRID:AB_2671360 | AC006449.2 | human | Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EGRSVLGGVSWFQCTESLGPLTLQHGNLGVDLLLFPSRQKLSFALSGPALGKGVGVNEQLF; Manufacturer approved use: IHC | polyclonal | rabbit | AB_2671360 | Atlas Antibodies | HPA023912 | 2025-08-19 08:03:35 | 0 | ||
|
Anti-IL17RB polyclonal antibody Resource Report Resource Website 1+ mentions Rating or validation data |
Atlas Antibodies Cat# HPA005482, RRID:AB_1234567 | IL17RB | human | PMID:26644354 | Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). | polyclonal | rabbit | AB_1234567 | Atlas Antibodies | HPA005482 | 2025-08-19 08:03:35 | 1 | |
|
DHX8 Antibody Resource Report Resource Website Discontinued Rating or validation data |
Thermo Fisher Scientific Cat# A300-624A, RRID:AB_513597 | DHX8 | Human, Mouse | Discontinued; Applications: IHC (1:200-1:1,000), IP (1-4 µg/mg lysate), WB (1:2,000-1:10,000) | polyclonal | rabbit | AB_513597 | Thermo Fisher Scientific | A300-624A | 2025-08-19 08:04:12 | 0 | ||
|
Anti-FKBP4 antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA006148, RRID:AB_1078875 | FKBP4 antibody produced in rabbit | human | Vendor recommendations: Other; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry | polyclonal | rabbit | AB_1078875 | Sigma-Aldrich | HPA006148 | 2025-08-19 08:06:14 | 0 | ||
|
Anti-ANKRD34A antibody produced in rabbit Resource Report Resource Website Rating or validation data |
Sigma-Aldrich Cat# HPA029643, RRID:AB_10601878 | ANKRD34A antibody produced in rabbit | human | Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry | polyclonal | rabbit | AB_10601878 | Sigma-Aldrich | HPA029643 | 2025-08-19 08:07:06 | 0 |
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.