Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10795714
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): PLA2G4C antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA043083, RRID:AB_10795714 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1854645
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human NRK
Proper citation: Sigma-Aldrich Cat# HPA017238, RRID:AB_1854645 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10966284
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Clonality: polyclonal
Target(s): MTERF antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA044894, RRID:AB_10966284 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10963432
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable
Clonality: polyclonal
Target(s): HS2ST1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA043603, RRID:AB_10963432 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080495
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): USP10
Proper citation: Atlas Antibodies Cat# HPA006731, RRID:AB_1080495 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_609484
Comments: Applications: WB, IP, IHC
Original Manufacturer
Host Organism: rabbit
Clonality: polyclonal
Target(s): SUPT5H
Proper citation: Bethyl Cat# A300-869A, RRID:AB_609484 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849474
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human GARNL4
Proper citation: Sigma-Aldrich Cat# HPA022148, RRID:AB_1849474 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847401
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human PPID
Proper citation: Sigma-Aldrich Cat# HPA019692, RRID:AB_1847401 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857062
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human SLC27A4
Proper citation: Sigma-Aldrich Cat# HPA007293, RRID:AB_1857062 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846053
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human CASP6
Proper citation: Sigma-Aldrich Cat# HPA011337, RRID:AB_1846053 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1857227
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human SLIT2
Proper citation: Sigma-Aldrich Cat# HPA023088, RRID:AB_1857227 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849404
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human PPP1R15A
Proper citation: Sigma-Aldrich Cat# HPA020240, RRID:AB_1849404 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2234186
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): LNPK
Proper citation: Atlas Antibodies Cat# HPA014205, RRID:AB_2234186 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2124997
Comments: Discontinued: 2016; validation status unknown check with seller; recommendations: ELISA; Immunoprecipitation; WB, IP, IF, IHC(P), ELISA; Immunofluorescence; Immunocytochemistry; Western Blot
Host Organism: rabbit
Clonality: polyclonal
Target(s): IL-17 (H-132)
Proper citation: Santa Cruz Biotechnology Cat# sc-7927, RRID:AB_2124997 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2117316
Comments: Discontinued: 2016; ENCODE PROJECT External validation DATA SET is released testing lot E0912 for K562,HepG2; status is awaiting lab characterization
Host Organism: goat
Clonality: polyclonal
Target(s): HNRNPC
Proper citation: Santa Cruz Biotechnology Cat# sc-10037, RRID:AB_2117316 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2671360
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence EGRSVLGGVSWFQCTESLGPLTLQHGNLGVDLLLFPSRQKLSFALSGPALGKGVGVNEQLF; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): AC006449.2
Proper citation: Atlas Antibodies Cat# HPA023912, RRID:AB_2671360 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1234567
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): IL17RB
Proper citation: Atlas Antibodies Cat# HPA005482, RRID:AB_1234567 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_513597
Comments: Discontinued; Applications: IHC (1:200-1:1,000), IP (1-4 µg/mg lysate), WB (1:2,000-1:10,000)
Host Organism: rabbit
Clonality: polyclonal
Target(s): DHX8
Proper citation: Thermo Fisher Scientific Cat# A300-624A, RRID:AB_513597 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078875
Comments: Vendor recommendations: Other; Western Blot; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): FKBP4 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA006148, RRID:AB_1078875 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601878
Comments: Vendor recommendations: indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): ANKRD34A antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA029643, RRID:AB_10601878 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.