Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-APEX2 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA030872, RRID:AB_10600981 APEX2 antibody produced in rabbit human Vendor recommendations: Other; Western Blot; Immunohistochemistry; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_10600981 Sigma-Aldrich HPA030872 2025-08-19 08:27:44 0
HMBOX1 antibody [N3C3]
 
Resource Report
Resource Website
Rating or validation data
GeneTex Cat# GTX104189, RRID:AB_2036940 HMBOX1 human Applications: WB, ICC/IF, IHC-P, IP polyclonal rabbit AB_2036940 GeneTex GTX104189 2025-08-19 08:27:26 0
Anti-FAM120B antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA037519, RRID:AB_10696935 FAM120B antibody produced in rabbit human Vendor recommendations: Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_10696935 Sigma-Aldrich HPA037519 2025-08-19 08:27:51 0
Anti-TUBGCP6 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA043928, RRID:AB_10960352 TUBGCP6 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10960352 Atlas Antibodies HPA043928 2025-08-19 08:27:58 0
Anti-CCDC66 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA044185, RRID:AB_10965852 CCDC66 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10965852 Atlas Antibodies HPA044185 2025-08-19 08:27:35 0
Anti-EPB42 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA040261, RRID:AB_10673441 EPB42 antibody produced in rabbit human Vendor recommendations: Immunohistochemistry; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_10673441 Sigma-Aldrich HPA040261 2025-08-19 08:27:36 0
Anti-RPL30 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA002651, RRID:AB_1079842 Human RPL30 human Vendor recommendations: unknown rabbit AB_1079842 Sigma-Aldrich HPA002651 2025-08-19 08:27:57 0
Anti-RPRD2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA061693, RRID:AB_2684587 RPRD2 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2684587 Atlas Antibodies HPA061693 2025-08-19 08:27:37 0
Anti-PAK1IP1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA030112, RRID:AB_10603125 PAK1IP1 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10603125 Atlas Antibodies HPA030112 2025-08-19 08:28:24 0
H3K4me3-human
 
Resource Report
Resource Website
50+ mentions
Rating or validation data
Millipore Cat# 07-473, RRID:AB_1977252 H3K4me3 homo sapiens ENCODE PROJECT External validation for lot# Unknown is available under ENCODE ID: ENCAB000ANU
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:TRUE, NonFunctional in animal:FALSE
polyclonal rabbit AB_1977252 Millipore 07-473 2025-08-19 08:28:19 85
Anti-GADL1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA040229, RRID:AB_10796118 GADL1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10796118 Atlas Antibodies HPA040229 2025-08-19 08:28:24 0
Anti-PHACTR2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA031720, RRID:AB_10670553 PHACTR2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10670553 Atlas Antibodies HPA031720 2025-08-19 08:28:18 0
Anti-CFAP46 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA038868, RRID:AB_2676247 CFAP46 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2676247 Atlas Antibodies HPA038868 2025-08-19 08:28:24 0
HDAC6-human
 
Resource Report
Resource Website
Discontinued
Discontinued
Rating or validation data
Bethyl Cat# A301-341A, RRID:AB_937896 HDAC6 Homo sapiens ENCODE PROJECT External validation DATA SET is released testing lot A301-341A-1 for SKNSH,K562,HepG2,GM12878; status is awaiting lab characterization unknown rabbit AB_937896 Bethyl A301-341A (also ENCAB000AHK) 2025-08-19 08:28:20 0
Anti-C1orf158 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA028396, RRID:AB_10603451 C1orf158 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VNPQPLSTPSWQIETKYSTKVLTGNWMEERRKFTRDTDKTPQSIYRKEYIPFPDHRPDQISRWYGKRKVEGLPYKHLITHHQ; Manufacturer approved use: IHC polyclonal rabbit AB_10603451 Atlas Antibodies HPA028396 2025-08-19 08:28:24 0
ENCODE - HOXA3
 
Resource Report
Resource Website
Discontinued
Rating or validation data
GeneTex Cat# GTX11945, RRID:AB_2753162 HOXA3 rat, mouse, human Discontinued; Applications: IHC-P, WB polyclonal rabbit AB_2753162 GeneTex GTX11945 (also ENCAB187YMT) 2025-08-19 08:28:29 0
Anti-AC005609.17 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA038276, RRID:AB_10795029 AC005609.17 antibody produced in rabbit human polyclonal rabbit AB_10795029 Atlas Antibodies HPA038276 2025-08-19 08:28:34 0
Anti-TBX22 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA003105, RRID:AB_1080225 TBX22 human polyclonal rabbit AB_1080225 Atlas Antibodies HPA003105 2025-08-19 08:28:21 0
Anti-NTNG2 Antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA065089, RRID:AB_2732730 NTNG2 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2732730 Atlas Antibodies HPA065089 2025-08-19 08:28:29 0
Anti-IQUB antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA020621, RRID:AB_1844380 IQUB human polyclonal rabbit AB_1844380 Atlas Antibodies HPA020621 2025-08-19 08:28:44 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.