Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes
Norway

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search
Reset search
On page 169 showing 3361 ~ 3380 out of 1,440,161 results
Snippet view Table view Download Top 1000 Results

Can't find the RRID you're searching for? X
Click the to add this resource to an Authentication Report or Collection

    • RRID:AB_2666287

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2666287

Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): GAB2

Proper citation: Atlas Antibodies Cat# HPA001368, RRID:AB_2666287 Copy   

    • RRID:AB_2543007

Discontinued

http://antibodyregistry.org/AB_2543007

Comments: Discontinued; Applications: Immunohistochemistry (1:50-100), Western Blot (1:100-500); Reactive Species: Human
Host Organism: rabbit
Clonality: polyclonal
Target(s): SPT16

Proper citation: Thermo Fisher Scientific Cat# PA5-25507, RRID:AB_2543007 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10610279

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): PHACTR2

Proper citation: Atlas Antibodies Cat# HPA031725, RRID:AB_10610279 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2682709

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TMEM170B

Proper citation: Atlas Antibodies Cat# HPA055134, RRID:AB_2682709 Copy   

    • RRID:AB_2543203

Discontinued

http://antibodyregistry.org/AB_2543203

Comments: Discontinued; Applications: Western Blot (1:100-500); Reactive Species: Human
Host Organism: rabbit
Clonality: polyclonal
Target(s): OR13C4

Proper citation: Thermo Fisher Scientific Cat# PA5-25703, RRID:AB_2543203 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2667540

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RYADRVKELSPHSGPSGEQLIQMETEEMEACSNGALIPGNLSKEEEELSSQMSSFNEAMTQIRELEEKAMEELKEIIQQGPDWLELSEMTEQPDYDLETFVNKAESALAQQAKHFSALR; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): KIF2C

Proper citation: Atlas Antibodies Cat# HPA006219, RRID:AB_2667540 Copy   

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1078701

Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TNFRSF21

Proper citation: Atlas Antibodies Cat# HPA006746, RRID:AB_1078701 Copy   

    • RRID:AB_10670967

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10670967

Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): AGA

Proper citation: Atlas Antibodies Cat# HPA031417, RRID:AB_10670967 Copy   

Discontinued

http://antibodyregistry.org/AB_2621421

Comments: Applications: WB, IP, IHC
Original Manufacturer
Host Organism: rabbit
Clonality: polyclonal
Target(s): CDKL5

Proper citation: Bethyl Cat# A304-172A, RRID:AB_2621421 Copy   

    • RRID:AB_2100435

http://antibodyregistry.org/AB_2100435

Comments: validation status unknown, seller recommendations provided in 2012:western blot, ELISA
Host Organism: rabbit
Clonality: polyclonal
Target(s): F10

Proper citation: Abcam Cat# ab80345, RRID:AB_2100435 Copy   

    • RRID:AB_3163105

http://antibodyregistry.org/AB_3163105

Comments: Applications: Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin
Host Organism: Rabbit
Clonality: polyclonal
Target(s): INT4

Proper citation: Novus Cat# NB100-60660F, RRID:AB_3163105 Copy   

http://antibodyregistry.org/AB_1855253

Comments: Vendor recommendations: Western Blot; immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): PGBD1 (AB2) antibody produced in rabbit

Proper citation: Sigma-Aldrich Cat# AV39704, RRID:AB_1855253 Copy   

http://antibodyregistry.org/AB_3152173

Comments: Applications: Western Blot
Host Organism: Rabbit
Clonality: polyclonal
Target(s): ZMPSTE24

Proper citation: Novus Cat# NB100-2388AF350, RRID:AB_3152173 Copy   

http://antibodyregistry.org/AB_1861456

Comments: validation status unknown, seller recommendations provided in 2012: ELISA; Western Blot; I-ELISA, sELISA, Western Blot
Host Organism: goat
Clonality: polyclonal
Target(s): Mouse CXCL16

Proper citation: Abcam Cat# ab84435, RRID:AB_1861456 Copy   

http://antibodyregistry.org/AB_3159541

Comments: Applications: Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin
Host Organism: Rabbit
Clonality: polyclonal
Target(s): FUS

Proper citation: Novus Cat# NB100-561APC, RRID:AB_3159541 Copy   

http://antibodyregistry.org/AB_3161642

Comments: Applications: Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin
Host Organism: Rabbit
Clonality: polyclonal
Target(s): USP47

Proper citation: Novus Cat# NB100-57487AF405, RRID:AB_3161642 Copy   

http://antibodyregistry.org/AB_3151784

Comments: Applications: Western Blot
Host Organism: Goat
Clonality: polyclonal
Target(s): RFC4

Proper citation: Novus Cat# NB100-233JF549, RRID:AB_3151784 Copy   

http://antibodyregistry.org/AB_3159339

Comments: Applications: Western Blot, Western Blot (Negative), Immunoprecipitation (Negative), Chromatin Immunoprecipitation (ChIP)
Host Organism: Rabbit
Clonality: polyclonal
Target(s): ARID1A

Proper citation: Novus Cat# NB100-55334AF750, RRID:AB_3159339 Copy   

    • RRID:AB_3161728

http://antibodyregistry.org/AB_3161728

Comments: Applications: Western Blot, Immunoprecipitation
Host Organism: Rabbit
Clonality: polyclonal
Target(s): BTAF1

Proper citation: Novus Cat# NB100-57501H, RRID:AB_3161728 Copy   

http://antibodyregistry.org/AB_3158105

Comments: Applications: Western Blot
Host Organism: Rabbit
Clonality: polyclonal
Target(s): FBXO44

Proper citation: Novus Cat# NB100-467MFV450, RRID:AB_3158105 Copy   

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X

  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within dkNET that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X

About

The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.

Recent News Entries

Join the Whole Person Physiome 1st Data Jamboree on August 24-25

Join Dr. Chen Li for a Knowledge Portal Network Webinar on the dkNET Computational Core on August 6

Join NIH ODSS Data Sharing and Reuse Seminar "PanKbase: An Open, FAIR Knowledge Base of the Human Pancreas to Accelerate Diabetes Research"

Contact Us

Email: info_at_ dknet.org

Stay Connected

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch