Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672614
Host Organism: rabbit
Clonality: polyclonal
Target(s): C10orf85 antibody produced in rabbit
Proper citation: Atlas Antibodies Cat# HPA037933, RRID:AB_10672614 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1853860
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human SLC38A10
Proper citation: Sigma-Aldrich Cat# HPA024631, RRID:AB_1853860 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845601
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human C17orf70
Proper citation: Sigma-Aldrich Cat# HPA023954, RRID:AB_1845601 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_609444
Comments: Applications: WB, IP, IHC
Original Manufacturer
Host Organism: rabbit
Clonality: polyclonal
Target(s): E1B-AP5
Proper citation: Bethyl Cat# A300-862A, RRID:AB_609444 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1846316
Comments: Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array
Host Organism: rabbit
Clonality: unknown
Target(s): Human ITGAV
Proper citation: Sigma-Aldrich Cat# HPA004856, RRID:AB_1846316 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078322
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry
Host Organism: rabbit
Clonality: polyclonal
Target(s): C14orf135 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA002076, RRID:AB_1078322 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601276
Comments: Vendor recommendations: Immunohistochemistry; Other; Western Blot; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): NPY1R antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA029903, RRID:AB_10601276 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601332
Comments: Vendor recommendations: Immunohistochemistry; Other; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): AIM2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA031365, RRID:AB_10601332 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079689
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality: unknown
Target(s): Human PTPN12
Proper citation: Sigma-Aldrich Cat# HPA007097, RRID:AB_1079689 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079378
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality: unknown
Target(s): Human HLA-DPB1
Proper citation: Sigma-Aldrich Cat# HPA011078, RRID:AB_1079378 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079620
Comments: Vendor recommendations:
Host Organism: rabbit
Clonality: unknown
Target(s): Human PINK1
Proper citation: Sigma-Aldrich Cat# HPA001931, RRID:AB_1079620 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10796347
Comments: Vendor recommendations: Other; Immunohistochemistry; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): EVX2 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA041576, RRID:AB_10796347 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2245776
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): CXorf61 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA004773, RRID:AB_2245776 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1080587
Host Organism: rabbit
Clonality: polyclonal
Target(s): AD000671.1, WBP7
Proper citation: Atlas Antibodies Cat# HPA006487, RRID:AB_1080587 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2047564
Comments: manufacturer recommendations: WB; Western Blot; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_2615147, AB_2047564.
Host Organism: rabbit
Clonality: unknown
Target(s): PTBP1 (polypyrimidine tract binding protein 1) (against the middle region of PTBP1) (50ug)
Proper citation: Aviva Systems Biology Cat# ARP40422_P050, RRID:AB_2047564 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686885
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence LAGPRWADPQISESNFSPKFNEKDGHVERKSKNGLYEIENGRPRNPAGRTGLVGRGLLGRWGPNHAADPIITRWKR; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): NUDT9
Proper citation: Atlas Antibodies Cat# HPA078535, RRID:AB_2686885 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680395
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KIAA0922
Proper citation: Atlas Antibodies Cat# HPA048443, RRID:AB_2680395 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1079905
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SEMA5A
Proper citation: Atlas Antibodies Cat# HPA004632, RRID:AB_1079905 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10673625
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): DDX21
Proper citation: Atlas Antibodies Cat# HPA036592, RRID:AB_10673625 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686874
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): APC2
Proper citation: Atlas Antibodies Cat# HPA078002, RRID:AB_2686874 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.