Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10794281
Comments: Vendor recommendations: Immunohistochemistry; Other; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): ITGA1 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA042555, RRID:AB_10794281 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_11175035
Comments: ENCODE PROJECT External validation DATA SET is released testing lot 40884 for not specified; status is not pursued
Host Organism: rabbit
Clonality: polyclonal
Target(s): AARS
Proper citation: GeneTex Cat# GTX112386, RRID:AB_11175035 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078077
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ABCA3
Proper citation: Atlas Antibodies Cat# HPA007884, RRID:AB_1078077 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10600711
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): HEXDC
Proper citation: Atlas Antibodies Cat# HPA027844, RRID:AB_10600711 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078294
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): BOLA1
Proper citation: Atlas Antibodies Cat# HPA007005, RRID:AB_1078294 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1852144
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KCNMB3
Proper citation: Atlas Antibodies Cat# HPA019185, RRID:AB_1852144 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2669392
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TMEM222
Proper citation: Atlas Antibodies Cat# HPA016579, RRID:AB_2669392 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1847310
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): CTBP2
Proper citation: Atlas Antibodies Cat# HPA023564, RRID:AB_1847310 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_355342
Comments: Applications: Western Blot, Neutralization, Immunocytochemistry
Host Organism: Goat
Clonality: polyclonal
Target(s): CXCL9/MIG
Proper citation: R and D Systems Cat# AF392, RRID:AB_355342 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10604272
Comments: ENCODE PROJECT External validation DATA SET is released testing lot QC8728 for not specified; status is not pursued
Host Organism: rabbit
Clonality: polyclonal
Target(s): ARNTL2
Proper citation: Sigma-Aldrich Cat# SAB2100154, RRID:AB_10604272 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10603247
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZNF582 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA028858, RRID:AB_10603247 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670570
Comments: Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): PKDREJ antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA034587, RRID:AB_10670570 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078420
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Other; Western Blot; Immunohistochemistry; Immunofluorescence
Host Organism: rabbit
Clonality: polyclonal
Target(s): CCDC22 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA000888, RRID:AB_1078420 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2183384
Comments: Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Immunofluorescence; Other; Western Blot
Host Organism: rabbit
Clonality: polyclonal
Target(s): SAMD9L antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA019465, RRID:AB_2183384 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2133570
Comments: Application(s): FFPE,Immunofluorescence,Immunohistochemistry,Immunoprecipitation,Western Blot; Date Deposited: 12/22/2004
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:TRUE, NonFunctional in animal:FALSE
Host Organism: rat
Clonality: monoclonal
Target(s): Keratin, type I; cytokeratin 19
Proper citation: DSHB Cat# TROMA-III, RRID:AB_2133570 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10796226
Comments: Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other
Host Organism: rabbit
Clonality: polyclonal
Target(s): NEK8 antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA040679, RRID:AB_10796226 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1849181
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): FUS
Proper citation: Atlas Antibodies Cat# HPA008784, RRID:AB_1849181 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681809
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKL; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): IL33
Proper citation: Atlas Antibodies Cat# HPA052386, RRID:AB_2681809 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1858672
Comments: Originating manufacturer of this product. Applications: IHC, WB. Genetic validation in WB by siRNA knockdown. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): USP25
Proper citation: Atlas Antibodies Cat# HPA018297, RRID:AB_1858672 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10961260
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): KBTBD7
Proper citation: Atlas Antibodies Cat# HPA043709, RRID:AB_10961260 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.