Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
http://antibodyregistry.org/AB_2516405
Comments: WB
Host Organism: rabbit
Clonality: unknown
Target(s): PIAS3
Proper citation: Creative Diagnostics Cat# DPABH-21353, RRID:AB_2516405 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2072056
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): CCDC146
Proper citation: Atlas Antibodies Cat# HPA020105, RRID:AB_2072056 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2667540
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RYADRVKELSPHSGPSGEQLIQMETEEMEACSNGALIPGNLSKEEEELSSQMSSFNEAMTQIRELEEKAMEELKEIIQQGPDWLELSEMTEQPDYDLETFVNKAESALAQQAKHFSALR; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): KIF2C
Proper citation: Atlas Antibodies Cat# HPA006219, RRID:AB_2667540 Copy
http://antibodyregistry.org/AB_2520606
Comments: WB, ICC/IF
Host Organism: rabbit
Clonality: unknown
Target(s): NKIRAS2
Proper citation: Creative Diagnostics Cat# DPABH-04046, RRID:AB_2520606 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078701
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TNFRSF21
Proper citation: Atlas Antibodies Cat# HPA006746, RRID:AB_1078701 Copy
http://antibodyregistry.org/AB_2524538
Comments: IHC-P, WB
Host Organism: rabbit
Clonality: unknown
Target(s): MCTP2
Proper citation: Creative Diagnostics Cat# DPABH-12356, RRID:AB_2524538 Copy
http://antibodyregistry.org/AB_2515386
Comments: IHC-P
Host Organism: rabbit
Clonality: unknown
Target(s): KLF10/11
Proper citation: Creative Diagnostics Cat# DPABH-01064, RRID:AB_2515386 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078756
Comments: Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): ELF3
Proper citation: Atlas Antibodies Cat# HPA003479, RRID:AB_1078756 Copy
http://antibodyregistry.org/AB_2509066
Comments: WB, IHC-P
Host Organism: rabbit
Clonality: unknown
Target(s): KLHL42
Proper citation: Creative Diagnostics Cat# DPABH-04770, RRID:AB_2509066 Copy
http://antibodyregistry.org/AB_2513897
Comments: ICC/IF, WB, IHC-P
Host Organism: rabbit
Clonality: unknown
Target(s): TPM1
Proper citation: Creative Diagnostics Cat# DPABH-16503, RRID:AB_2513897 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670967
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): AGA
Proper citation: Atlas Antibodies Cat# HPA031417, RRID:AB_10670967 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10672746
Comments: Originating manufacturer of this product. Applications: IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): BFSP2
Proper citation: Atlas Antibodies Cat# HPA038464, RRID:AB_10672746 Copy
Discontinued
http://antibodyregistry.org/AB_2621421
Comments: Applications: WB, IP, IHC
Original Manufacturer
Host Organism: rabbit
Clonality: polyclonal
Target(s): CDKL5
Proper citation: Bethyl Cat# A304-172A, RRID:AB_2621421 Copy
http://antibodyregistry.org/AB_2516621
Comments: WB, IHC-P
Host Organism: rabbit
Clonality: unknown
Target(s): PFKFB3
Proper citation: Creative Diagnostics Cat# DPABH-02818, RRID:AB_2516621 Copy
http://antibodyregistry.org/AB_2515379
Comments: IHC - Wholemount, IHC-P, IHC-Fr, WB, ELISA
Host Organism: rabbit
Clonality: unknown
Target(s): GAD65 / GAD67
Proper citation: Creative Diagnostics Cat# DPABH-00431, RRID:AB_2515379 Copy
http://antibodyregistry.org/AB_2513950
Comments: WB, IHC-P
Host Organism: rabbit
Clonality: unknown
Target(s): GNAS
Proper citation: Creative Diagnostics Cat# DPABH-16616, RRID:AB_2513950 Copy
http://antibodyregistry.org/AB_2522601
Comments: WB
Host Organism: rabbit
Clonality: unknown
Target(s): ZNF398
Proper citation: Creative Diagnostics Cat# DPABH-08409, RRID:AB_2522601 Copy
http://antibodyregistry.org/AB_2613989
Comments: ELISA,Immunohistochemistry,IF Microscopy,Western Blot, Anti-TLR9 Antibody has been tested for use in ELISA, Western Blotting, Immunohistochemistry and Immunofluorescence
Host Organism: rabbit
Clonality: unknown
Target(s): TLR9 Antibody
Proper citation: Rockland Cat# 600-401-FG6, RRID:AB_2613989 Copy
http://antibodyregistry.org/AB_2100435
Comments: validation status unknown, seller recommendations provided in 2012:western blot, ELISA
Host Organism: rabbit
Clonality: polyclonal
Target(s): F10
Proper citation: Abcam Cat# ab80345, RRID:AB_2100435 Copy
http://antibodyregistry.org/AB_3163105
Comments: Applications: Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin
Host Organism: Rabbit
Clonality: polyclonal
Target(s): INT4
Proper citation: Novus Cat# NB100-60660F, RRID:AB_3163105 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.