Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2335999
Comments: Used By NYUIHC-1208
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:FALSE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality: monoclonal
Target(s): ND
Proper citation: Ventana Medical Systems Cat# 760-4257, RRID:AB_2335999 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10599828
Comments: Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): YKT6
Proper citation: Atlas Antibodies Cat# HPA030817, RRID:AB_10599828 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681008
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RB1
Proper citation: Atlas Antibodies Cat# HPA050082, RRID:AB_2681008 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10805710
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): INTS14
Proper citation: Atlas Antibodies Cat# HPA040255, RRID:AB_10805710 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10601958
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): CPT2
Proper citation: Atlas Antibodies Cat# HPA028214, RRID:AB_10601958 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683657
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SLC25A51
Proper citation: Atlas Antibodies Cat# HPA058261, RRID:AB_2683657 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685597
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): C1QTNF3
Proper citation: Atlas Antibodies Cat# HPA066011, RRID:AB_2685597 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2677217
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): RTN1
Proper citation: Atlas Antibodies Cat# HPA040945, RRID:AB_2677217 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2156427
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): P4HA3
Proper citation: Atlas Antibodies Cat# HPA007897, RRID:AB_2156427 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2685448
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PTAYEDEVSFLDAHSRYHTVHELSA; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): NRTN
Proper citation: Atlas Antibodies Cat# HPA065260, RRID:AB_2685448 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2681523
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TBL2
Proper citation: Atlas Antibodies Cat# HPA051533, RRID:AB_2681523 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2679536
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence AFYHQGYAAGPYHHHQPMPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPK; Manufacturer approved use: ICC-IF, WB
Host Organism: rabbit
Clonality: polyclonal
Target(s): HOXA13
Proper citation: Atlas Antibodies Cat# HPA046098, RRID:AB_2679536 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2680900
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ST3GAL4
Proper citation: Atlas Antibodies Cat# HPA049827, RRID:AB_2680900 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2683025
Host Organism: rabbit
Clonality: unknown
Target(s): PSMD7
Proper citation: Sigma-Aldrich Cat# HPA056069, RRID:AB_2683025 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_301278
Comments: ENCODE PROJECT External validation DATA SET is released testing lot unknown for not specified; status is not eligible for new data
Host Organism: rabbit
Clonality: polyclonal
Target(s): XRCC4
Proper citation: Abcam Cat# ab145, RRID:AB_301278 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2684660
Host Organism: rabbit
Clonality: unknown
Target(s): PRL
Proper citation: Sigma-Aldrich Cat# HPA062017, RRID:AB_2684660 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686817
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence ALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): PI4K2A
Proper citation: Atlas Antibodies Cat# HPA076857, RRID:AB_2686817 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682020
Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): C17orf105
Proper citation: Atlas Antibodies Cat# HPA053028, RRID:AB_2682020 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1859011
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): ZFAND3
Proper citation: Atlas Antibodies Cat# HPA016755, RRID:AB_1859011 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10796454
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: unknown
Target(s): SPG21
Proper citation: Atlas Antibodies Cat# HPA040436, RRID:AB_10796454 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.