Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-C1orf158 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA028396, RRID:AB_10603451 C1orf158 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence VNPQPLSTPSWQIETKYSTKVLTGNWMEERRKFTRDTDKTPQSIYRKEYIPFPDHRPDQISRWYGKRKVEGLPYKHLITHHQ; Manufacturer approved use: IHC polyclonal rabbit AB_10603451 Atlas Antibodies HPA028396 2025-08-19 08:28:24 0
ENCODE - HOXA3
 
Resource Report
Resource Website
Discontinued
Rating or validation data
GeneTex Cat# GTX11945, RRID:AB_2753162 HOXA3 rat, mouse, human Discontinued; Applications: IHC-P, WB polyclonal rabbit AB_2753162 GeneTex GTX11945 (also ENCAB187YMT) 2025-08-19 08:28:29 0
Anti-AC005609.17 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA038276, RRID:AB_10795029 AC005609.17 antibody produced in rabbit human polyclonal rabbit AB_10795029 Atlas Antibodies HPA038276 2025-08-19 08:28:34 0
Anti-TBX22 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA003105, RRID:AB_1080225 TBX22 human polyclonal rabbit AB_1080225 Atlas Antibodies HPA003105 2025-08-19 08:28:21 0
Anti-NTNG2 Antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA065089, RRID:AB_2732730 NTNG2 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2732730 Atlas Antibodies HPA065089 2025-08-19 08:28:29 0
Anti-IQUB antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA020621, RRID:AB_1844380 IQUB human polyclonal rabbit AB_1844380 Atlas Antibodies HPA020621 2025-08-19 08:28:44 0
Anti-NOC4L antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA046362, RRID:AB_10959589 NOC4L antibody produced in rabbit human polyclonal AB_10959589 Atlas Antibodies HPA046362 2025-08-19 08:28:44 0
Anti-LIN52 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA000900, RRID:AB_2135058 LIN52 antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry polyclonal rabbit AB_2135058 Sigma-Aldrich HPA000900 2025-08-19 08:28:45 0
Phospho-GSK-3 (Ser9) Antibody
 
Resource Report
Resource Website
50+ mentions
Rating or validation data
Cell Signaling Technology Cat# 9336, RRID:AB_331405 Phospho-GSK-3 (Ser9) b, rat, h, m, mouse, r, zebrafishfish, bovine, z, human, mk Applications: W. Consolidation: AB_331406.
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
polyclonal rabbit AB_331405 Cell Signaling Technology 9336 (also 9336S, 9336L) 2025-08-19 08:31:23 74
Anti-COL6A2
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA007029, RRID:AB_1078549 COL6A2 human Originating manufacturer of this product. Applications: IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1078549 Atlas Antibodies HPA007029 2025-08-19 08:31:25 0
Anti-NAGK
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA035207, RRID:AB_10602031 NAGK human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10602031 Atlas Antibodies HPA035207 2025-08-19 08:31:26 1
Anti-MAGEA11 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA045377, RRID:AB_10960210 MAGEA11 antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal AB_10960210 Sigma-Aldrich HPA045377 2025-08-19 08:31:32 0
Anti-ISY1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA006312, RRID:AB_1079734 ISY1 antibody produced in rabbit human Vendor recommendations: Other; Immunofluorescence; Western Blot; Immunohistochemistry; indirect immunofluorescence: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_1079734 Sigma-Aldrich HPA006312 2025-08-19 08:31:36 0
Anti-YB-1 (C-terminal) antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# Y0396, RRID:AB_1841274 YB-1 (C-terminal) antibody produced in rabbit rat, mouse, human Vendor recommendations: Immunofluorescence; Western Blot; Immunoprecipitation; indirect immunofluorescence: 2-5 mug/mL polyclonal rabbit AB_1841274 Sigma-Aldrich Y0396 2025-08-19 08:31:50 0
Anti-RGP1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA021085, RRID:AB_1852291 RGP1 antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Immunohistochemistry; Other polyclonal rabbit AB_1852291 Sigma-Aldrich HPA021085 2025-08-19 08:31:54 0
Anti-ARHGAP36 antibody produced in rabbit
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Sigma-Aldrich Cat# HPA002064, RRID:AB_1078891 ARHGAP36 human Vendor recommendations: unknown rabbit AB_1078891 Sigma-Aldrich HPA002064 2025-08-19 08:31:48 1
Anti-NHLH1
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA017943, RRID:AB_2732421 NHLH1 human unknown rabbit AB_2732421 Sigma-Aldrich HPA017943 2025-08-19 08:32:09 0
Anti-ADGRE5 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA013707, RRID:AB_1846345 ADGRE5 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1846345 Atlas Antibodies HPA013707 2025-08-19 08:32:15 2
Slit1 (E-16)
 
Resource Report
Resource Website
Discontinued
Rating or validation data
Santa Cruz Biotechnology Cat# sc-16616, RRID:AB_656536 Slit1 (E-16) rat, mouse, rabbit, human Discontinued: 2016; validation status unknown check with seller; recommendations: ELISA; Immunocytochemistry; Immunofluorescence; Western Blot; WB, IHC polyclonal rabbit AB_656536 Santa Cruz Biotechnology sc-16616 2025-08-19 08:32:16 0
Anti-POLR3D polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA069089, RRID:AB_2686081 POLR3D human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2686081 Atlas Antibodies HPA069089 2025-08-19 08:32:17 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.