Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 157 showing 3121 ~ 3140 out of 1,440,138 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2682709

Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TMEM170B

Proper citation: Atlas Antibodies Cat# HPA055134, RRID:AB_2682709 Copy   


  • RRID:AB_2543203

Discontinued

http://antibodyregistry.org/AB_2543203

Comments: Discontinued; Applications: Western Blot (1:100-500); Reactive Species: Human
Host Organism: rabbit
Clonality: polyclonal
Target(s): OR13C4

Proper citation: Thermo Fisher Scientific Cat# PA5-25703, RRID:AB_2543203 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_2667540

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RYADRVKELSPHSGPSGEQLIQMETEEMEACSNGALIPGNLSKEEEELSSQMSSFNEAMTQIRELEEKAMEELKEIIQQGPDWLELSEMTEQPDYDLETFVNKAESALAQQAKHFSALR; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): KIF2C

Proper citation: Atlas Antibodies Cat# HPA006219, RRID:AB_2667540 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1078701

Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TNFRSF21

Proper citation: Atlas Antibodies Cat# HPA006746, RRID:AB_1078701 Copy   


  • RRID:AB_10670967

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10670967

Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): AGA

Proper citation: Atlas Antibodies Cat# HPA031417, RRID:AB_10670967 Copy   


Discontinued

http://antibodyregistry.org/AB_2621421

Comments: Applications: WB, IP, IHC
Original Manufacturer
Host Organism: rabbit
Clonality: polyclonal
Target(s): CDKL5

Proper citation: Bethyl Cat# A304-172A, RRID:AB_2621421 Copy   


  • RRID:AB_2850956

http://antibodyregistry.org/AB_2850956

Comments: Applications: WB (1:500-1:1,000), ICC/IF (1:100-1:500)
Host Organism: rabbit
Clonality: polyclonal
Target(s): CSPG5

Proper citation: Thermo Fisher Scientific Cat# PA5-101522, RRID:AB_2850956 Copy   


http://antibodyregistry.org/AB_1579219

Comments: manufacturer recommendations: WB-Ce,Det Ab,WB-Tr; Western Blot
Host Organism: mouse
Clonality: polyclonal
Target(s): PRR11 purified MaxPab mouse polyclonal antibody (B01P)

Proper citation: Abnova Cat# H00055771-B01P, RRID:AB_1579219 Copy   


  • RRID:AB_961026

Discontinued

http://antibodyregistry.org/AB_961026

Comments: Discontinued; Applications: IP (2-5 µg/mg lysate), WB (1:2,000-1:10,000)
Host Organism: rabbit
Clonality: polyclonal
Target(s): IRS2

Proper citation: Thermo Fisher Scientific Cat# A301-433A, RRID:AB_961026 Copy   


  • RRID:AB_2815775

http://antibodyregistry.org/AB_2815775

Comments: Applications: WB (1:500-1:2,000)
Host Organism: rabbit
Clonality: polyclonal
Target(s): EXOSC8

Proper citation: Thermo Fisher Scientific Cat# PA5-100245, RRID:AB_2815775 Copy   


  • RRID:AB_2900645

http://antibodyregistry.org/AB_2900645

Comments: Applications: ICC/IF (1:100-1:500), WB (1:500-1:1,000)
Host Organism: rabbit
Clonality: polyclonal
Target(s): TBX10

Proper citation: Thermo Fisher Scientific Cat# PA5-116011, RRID:AB_2900645 Copy   


http://antibodyregistry.org/AB_2890003

Comments: Applications: IHC, WB, Flo, ELISA
Host Organism: rabbit
Clonality: polyclonal
Target(s): FMOD

Proper citation: LSBio (LifeSpan) Cat# LS-C257324, RRID:AB_2890003 Copy   


http://antibodyregistry.org/AB_2913125

Comments: Applications: WB (1:1,000-1:10,000)
Host Organism: rabbit
Clonality: polyclonal
Target(s): Flavivirus Envelope

Proper citation: Thermo Fisher Scientific Cat# PA5-119552, RRID:AB_2913125 Copy   


http://antibodyregistry.org/AB_10895080

Comments: manufacturer recommendations: IF, Flow-Cyt
Host Organism: goat
Clonality: polyclonal
Target(s): Goat Human IgG Secondary PE

Proper citation: Bioss Cat# bs-0297G-PE, RRID:AB_10895080 Copy   


  • RRID:AB_2892839

    This resource has 1+ mentions.

http://antibodyregistry.org/AB_2892839

Comments: Applications: ELISA, WB, IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): GSTM2

Proper citation: Sangon Biotech Cat# D223809, RRID:AB_2892839 Copy   


http://antibodyregistry.org/AB_211819

Comments: seller recommendations: IgG Immunoblotting
Host Organism: rabbit
Clonality: polyclonal
Target(s): ERAB (101-119) Mouse (Rabbit)

Proper citation: Millipore Cat# 324918-100UL, RRID:AB_211819 Copy   


http://antibodyregistry.org/AB_1158079

Comments: functionality unknown, check validation data for this product with vendor
Clonality: polyclonal
Target(s): ACTH

Proper citation: Cell Marque Cat# 206A-74, RRID:AB_1158079 Copy   


http://antibodyregistry.org/AB_2887655

Comments: Applications: WB, ICC/IF
Host Organism: rabbit
Clonality: polyclonal

Proper citation: GeneTex Cat# GTX32425, RRID:AB_2887655 Copy   


  • RRID:AB_1851212

http://antibodyregistry.org/AB_1851212

Comments: Originating manufacturer of this product.
Applications: IHC, ELISA
Host Organism: rabbit
Clonality: polyclonal
Target(s): HBQ1

Proper citation: Proteintech Cat# 16706-1-AP, RRID:AB_1851212 Copy   


  • RRID:AB_11042600

http://antibodyregistry.org/AB_11042600

Comments: Originating manufacturer of this product.
Applications: WB, IHC, IF, ELISA
Host Organism: rabbit
Clonality: polyclonal
Target(s): ER

Proper citation: Proteintech Cat# 21244-1-AP, RRID:AB_11042600 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within dkNET that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X