Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2682709
Comments: Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TMEM170B
Proper citation: Atlas Antibodies Cat# HPA055134, RRID:AB_2682709 Copy
Discontinued
http://antibodyregistry.org/AB_2543203
Comments: Discontinued; Applications: Western Blot (1:100-500); Reactive Species: Human
Host Organism: rabbit
Clonality: polyclonal
Target(s): OR13C4
Proper citation: Thermo Fisher Scientific Cat# PA5-25703, RRID:AB_2543203 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2667540
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RYADRVKELSPHSGPSGEQLIQMETEEMEACSNGALIPGNLSKEEEELSSQMSSFNEAMTQIRELEEKAMEELKEIIQQGPDWLELSEMTEQPDYDLETFVNKAESALAQQAKHFSALR; Manufacturer approved use: ICC-IF
Host Organism: rabbit
Clonality: polyclonal
Target(s): KIF2C
Proper citation: Atlas Antibodies Cat# HPA006219, RRID:AB_2667540 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1078701
Comments: Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): TNFRSF21
Proper citation: Atlas Antibodies Cat# HPA006746, RRID:AB_1078701 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10670967
Comments: Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): AGA
Proper citation: Atlas Antibodies Cat# HPA031417, RRID:AB_10670967 Copy
Discontinued
http://antibodyregistry.org/AB_2621421
Comments: Applications: WB, IP, IHC
Original Manufacturer
Host Organism: rabbit
Clonality: polyclonal
Target(s): CDKL5
Proper citation: Bethyl Cat# A304-172A, RRID:AB_2621421 Copy
http://antibodyregistry.org/AB_2850956
Comments: Applications: WB (1:500-1:1,000), ICC/IF (1:100-1:500)
Host Organism: rabbit
Clonality: polyclonal
Target(s): CSPG5
Proper citation: Thermo Fisher Scientific Cat# PA5-101522, RRID:AB_2850956 Copy
http://antibodyregistry.org/AB_1579219
Comments: manufacturer recommendations: WB-Ce,Det Ab,WB-Tr; Western Blot
Host Organism: mouse
Clonality: polyclonal
Target(s): PRR11 purified MaxPab mouse polyclonal antibody (B01P)
Proper citation: Abnova Cat# H00055771-B01P, RRID:AB_1579219 Copy
Discontinued
http://antibodyregistry.org/AB_961026
Comments: Discontinued; Applications: IP (2-5 µg/mg lysate), WB (1:2,000-1:10,000)
Host Organism: rabbit
Clonality: polyclonal
Target(s): IRS2
Proper citation: Thermo Fisher Scientific Cat# A301-433A, RRID:AB_961026 Copy
http://antibodyregistry.org/AB_2815775
Comments: Applications: WB (1:500-1:2,000)
Host Organism: rabbit
Clonality: polyclonal
Target(s): EXOSC8
Proper citation: Thermo Fisher Scientific Cat# PA5-100245, RRID:AB_2815775 Copy
http://antibodyregistry.org/AB_2900645
Comments: Applications: ICC/IF (1:100-1:500), WB (1:500-1:1,000)
Host Organism: rabbit
Clonality: polyclonal
Target(s): TBX10
Proper citation: Thermo Fisher Scientific Cat# PA5-116011, RRID:AB_2900645 Copy
http://antibodyregistry.org/AB_2890003
Comments: Applications: IHC, WB, Flo, ELISA
Host Organism: rabbit
Clonality: polyclonal
Target(s): FMOD
Proper citation: LSBio (LifeSpan) Cat# LS-C257324, RRID:AB_2890003 Copy
http://antibodyregistry.org/AB_2913125
Comments: Applications: WB (1:1,000-1:10,000)
Host Organism: rabbit
Clonality: polyclonal
Target(s): Flavivirus Envelope
Proper citation: Thermo Fisher Scientific Cat# PA5-119552, RRID:AB_2913125 Copy
http://antibodyregistry.org/AB_10895080
Comments: manufacturer recommendations: IF, Flow-Cyt
Host Organism: goat
Clonality: polyclonal
Target(s): Goat Human IgG Secondary PE
Proper citation: Bioss Cat# bs-0297G-PE, RRID:AB_10895080 Copy
http://antibodyregistry.org/AB_2892839
Comments: Applications: ELISA, WB, IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): GSTM2
Proper citation: Sangon Biotech Cat# D223809, RRID:AB_2892839 Copy
http://antibodyregistry.org/AB_211819
Comments: seller recommendations: IgG Immunoblotting
Host Organism: rabbit
Clonality: polyclonal
Target(s): ERAB (101-119) Mouse (Rabbit)
Proper citation: Millipore Cat# 324918-100UL, RRID:AB_211819 Copy
http://antibodyregistry.org/AB_1158079
Comments: functionality unknown, check validation data for this product with vendor
Clonality: polyclonal
Target(s): ACTH
Proper citation: Cell Marque Cat# 206A-74, RRID:AB_1158079 Copy
http://antibodyregistry.org/AB_2887655
Comments: Applications: WB, ICC/IF
Host Organism: rabbit
Clonality: polyclonal
Proper citation: GeneTex Cat# GTX32425, RRID:AB_2887655 Copy
http://antibodyregistry.org/AB_1851212
Comments: Originating manufacturer of this product.
Applications: IHC, ELISA
Host Organism: rabbit
Clonality: polyclonal
Target(s): HBQ1
Proper citation: Proteintech Cat# 16706-1-AP, RRID:AB_1851212 Copy
http://antibodyregistry.org/AB_11042600
Comments: Originating manufacturer of this product.
Applications: WB, IHC, IF, ELISA
Host Organism: rabbit
Clonality: polyclonal
Target(s): ER
Proper citation: Proteintech Cat# 21244-1-AP, RRID:AB_11042600 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.