Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

Norway

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search
Reset search
Filter by records added date

See new records

Options

Current Facets and Filters

  • Clonality:polyclonal (facet)

Facets

Recent searches

Snippet view Table view

Can't find the RRID you're searching for? X
Click the to add this resource to an Authentication Report or Collection

1,440,138 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name

Sort Ascending

Sort Descending

 Proper Citation

Sort Ascending

Sort Descending

 Target Antigen

Sort Ascending

Sort Descending

 Target Organism

Sort Ascending

Sort Descending

 Clone ID
Defining Citation

Sort Ascending

Sort Descending

 Comments
Clonality

Sort Ascending

Sort Descending

 Host Organism

Sort Ascending

Sort Descending

 Antibody ID
Vendor

Sort Ascending

Sort Descending

 Catalog Number
Record Last Update

Sort Ascending

Sort Descending

 Mentions Count

Sort Ascending

Sort Descending
Anti-TMEM170B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA055134, RRID:AB_2682709 TMEM170B human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2682709 Atlas Antibodies HPA055134 2025-08-19 10:25:26 0
OR13C4 Antibody
 
Resource Report
Resource Website
Discontinued 		Thermo Fisher Scientific Cat# PA5-25703, RRID:AB_2543203 OR13C4 human Discontinued; Applications: Western Blot (1:100-500); Reactive Species: Human polyclonal rabbit AB_2543203 Thermo Fisher Scientific PA5-25703 2025-08-19 10:25:19 0
Anti-KIF2C polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA006219, RRID:AB_2667540 KIF2C human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence RYADRVKELSPHSGPSGEQLIQMETEEMEACSNGALIPGNLSKEEEELSSQMSSFNEAMTQIRELEEKAMEELKEIIQQGPDWLELSEMTEQPDYDLETFVNKAESALAQQAKHFSALR; Manufacturer approved use: ICC-IF polyclonal rabbit AB_2667540 Atlas Antibodies HPA006219 2025-08-19 10:25:23 0
Anti-TNFRSF21 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA006746, RRID:AB_1078701 TNFRSF21 human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1078701 Atlas Antibodies HPA006746 2025-08-19 10:25:23 0
Anti-AGA polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data 		Atlas Antibodies Cat# HPA031417, RRID:AB_10670967 AGA human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10670967 Atlas Antibodies HPA031417 2025-08-19 10:25:26 0
Rabbit anti-CDKL5 Antibody, Affinity Purified
 
Resource Report
Resource Website
Discontinued 		Bethyl Cat# A304-172A, RRID:AB_2621421 CDKL5 human Applications: WB, IP, IHC
Original Manufacturer 		polyclonal rabbit AB_2621421 Bethyl A304-172A (also OWL-A19655, A304-172A-T, A304-172A-M) 2025-08-19 10:25:21 0
CSPG5 Polyclonal Antibody
 
Resource Report
Resource Website 		Thermo Fisher Scientific Cat# PA5-101522, RRID:AB_2850956 CSPG5 rat, mouse, human Applications: WB (1:500-1:1,000), ICC/IF (1:100-1:500) polyclonal rabbit AB_2850956 Thermo Fisher Scientific PA5-101522 2025-08-19 10:25:33 0
PRR11 purified MaxPab mouse polyclonal antibody (B01P)
 
Resource Report
Resource Website 		Abnova Cat# H00055771-B01P, RRID:AB_1579219 PRR11 purified MaxPab mouse polyclonal antibody (B01P) human manufacturer recommendations: WB-Ce,Det Ab,WB-Tr; Western Blot polyclonal mouse AB_1579219 Abnova H00055771-B01P 2025-08-19 10:25:29 0
IRS2 Antibody
 
Resource Report
Resource Website
Discontinued 		Thermo Fisher Scientific Cat# A301-433A, RRID:AB_961026 IRS2 human Discontinued; Applications: IP (2-5 µg/mg lysate), WB (1:2,000-1:10,000) polyclonal rabbit AB_961026 Thermo Fisher Scientific A301-433A 2025-08-19 10:25:29 0
EXOSC8 Polyclonal Antibody
 
Resource Report
Resource Website 		Thermo Fisher Scientific Cat# PA5-100245, RRID:AB_2815775 EXOSC8 rat, mouse, human Applications: WB (1:500-1:2,000) polyclonal rabbit AB_2815775 Thermo Fisher Scientific PA5-100245 2025-08-19 10:25:28 0
TBX10 Polyclonal Antibody
 
Resource Report
Resource Website 		Thermo Fisher Scientific Cat# PA5-116011, RRID:AB_2900645 TBX10 human Applications: ICC/IF (1:100-1:500), WB (1:500-1:1,000) polyclonal rabbit AB_2900645 Thermo Fisher Scientific PA5-116011 2025-08-19 10:25:29 0
Polyclonal Rabbit anti‑Human FMOD / Fibromodulin Antibody (PE)
 
Resource Report
Resource Website 		LSBio (LifeSpan) Cat# LS-C257324, RRID:AB_2890003 FMOD mouse, human Applications: IHC, WB, Flo, ELISA polyclonal rabbit AB_2890003 LSBio (LifeSpan) LS-C257324 2025-08-19 10:25:29 0
Flavivirus Envelope Polyclonal Antibody
 
Resource Report
Resource Website 		Thermo Fisher Scientific Cat# PA5-119552, RRID:AB_2913125 Flavivirus Envelope virus Applications: WB (1:1,000-1:10,000) polyclonal rabbit AB_2913125 Thermo Fisher Scientific PA5-119552 2025-08-19 10:25:35 0
Goat Anti-Human IgG Secondary Antibody, PE Conjugated
 
Resource Report
Resource Website 		Bioss Cat# bs-0297G-PE, RRID:AB_10895080 Goat Human IgG Secondary PE human manufacturer recommendations: IF, Flow-Cyt polyclonal goat AB_10895080 Bioss bs-0297G-PE 2025-08-19 10:25:35 0
Anti-GSTM2 rabbit polyclonal antibody
 
Resource Report
Resource Website
1+ mentions 		Sangon Biotech Cat# D223809, RRID:AB_2892839 GSTM2 mouse, human Applications: ELISA, WB, IHC polyclonal rabbit AB_2892839 Sangon Biotech D223809 2025-08-19 10:25:35 1
Anti-ERAB (101-119), Mouse (Rabbit)
 
Resource Report
Resource Website 		Millipore Cat# 324918-100UL, RRID:AB_211819 ERAB (101-119) Mouse (Rabbit) human seller recommendations: IgG Immunoblotting polyclonal rabbit AB_211819 Millipore 324918-100UL 2025-08-19 10:25:31 0
Anti-ACTH Polyclonal Antibody, Unconjugated
 
Resource Report
Resource Website 		Cell Marque Cat# 206A-74, RRID:AB_1158079 ACTH functionality unknown, check validation data for this product with vendor polyclonal AB_1158079 Cell Marque 206A-74 2025-08-19 10:25:32 0
Adiponectin Receptor 1 antibody
 
Resource Report
Resource Website 		GeneTex Cat# GTX32425, RRID:AB_2887655 mouse, human Applications: WB, ICC/IF polyclonal rabbit AB_2887655 GeneTex GTX32425 2025-08-19 10:25:34 0
HBQ1 antibody
 
Resource Report
Resource Website 		Proteintech Cat# 16706-1-AP, RRID:AB_1851212 HBQ1 human Originating manufacturer of this product.
Applications: IHC, ELISA 		polyclonal rabbit AB_1851212 Proteintech 16706-1-AP 2025-08-19 10:25:40 0
ER antibody
 
Resource Report
Resource Website 		Proteintech Cat# 21244-1-AP, RRID:AB_11042600 ER rat, cow, mouse, human Originating manufacturer of this product.
Applications: WB, IHC, IF, ELISA 		polyclonal rabbit AB_11042600 Proteintech 21244-1-AP 2025-08-19 10:25:31 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X

  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search

  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

About

The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant U24DK097771.

Recent News Entries

Join Dr. Chen Li for a Knowledge Portal Network Webinar on the dkNET Computational Core on August 6

Join NIH ODSS Data Sharing and Reuse Seminar "PanKbase: An Open, FAIR Knowledge Base of the Human Pancreas to Accelerate Diabetes Research"

Join the NIDDK-CR Webinar "Design Patterns for Reproducible Research" on July 29, 2026

Contact Us

Email: info_at_ dknet.org

Stay Connected

About SciCrunch | Privacy Policy | Terms of Service

SciCrunch