Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-PRRT1 Antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA059099, RRID:AB_2732632 PRRT1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_2732632 Atlas Antibodies HPA059099 2025-08-19 09:17:45 0
Rabbit Anti-Human YYY4, Unconjugated
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA003532, RRID:AB_1079355 YYY4 human unknown rabbit AB_1079355 Atlas Antibodies HPA003532 2025-08-19 09:17:05 0
Anti-OCA2 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA036403, RRID:AB_10671225 OCA2 antibody produced in rabbit human polyclonal rabbit AB_10671225 Atlas Antibodies HPA036403 2025-08-19 09:17:05 0
Pancreatic Polypeptide (human) - Undiluted Antiserum for Immunohistochemistry, Host: Rabbit
 
Resource Report
Resource Website
1+ mentions
Discontinued
Rating or validation data
Peninsula Laboratories Cat# T-4088.0050, RRID:AB_518533 Pancreatic Polypeptide (human) - Undiluted Antiserum for Immunohistochemistry Host: Rabbit human Discontinued: 2014; manufacturer recommendations: Immunohistochemistry; Immunohistochemistry unknown rabbit AB_518533 Peninsula Laboratories T-4088.0050 2025-08-19 09:17:26 1
Anti-AP000569.1 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA019164, RRID:AB_1859549 AP000569.1 antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; Other; Immunohistochemistry polyclonal rabbit AB_1859549 Sigma-Aldrich HPA019164 2025-08-19 09:17:58 0
CD 44, Phagocytic Glycoprotein-1, Homing Cell adhesion Molecule (H-CAM)
 
Resource Report
Resource Website
Rating or validation data
Innovative Research Cat# 3-Jul, RRID:AB_2336026 ND [DF1485] Used By NYUIHC-18
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
monoclonal mouse AB_2336026 Innovative Research 3-Jul 2025-08-19 09:11:02 0
Anti-SCOC polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA061198, RRID:AB_2684449 SCOC human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2684449 Atlas Antibodies HPA061198 2025-08-19 09:12:04 0
Rabbit anti-Pescadillo Antibody, Affinity Purified
 
Resource Report
Resource Website
1+ mentions
Discontinued
Rating or validation data
Bethyl Cat# A300-903A, RRID:AB_625300 Pescadillo human Applications: WB, IP polyclonal rabbit AB_625300 Bethyl A300-903A (also A300-903A-M, A300-903A-T) 2025-08-19 09:12:02 1
Anti-ZNF583 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA023957, RRID:AB_2671383 ZNF583 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2671383 Atlas Antibodies HPA023957 2025-08-19 09:11:17 0
Anti-ZNF443 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA003150, RRID:AB_1080725 ZNF443 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1080725 Atlas Antibodies HPA003150 2025-08-19 09:12:03 0
Anti-DNAH10 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA039065, RRID:AB_2676329 DNAH10 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence TAKGVMSDPNFLRSLMEIDFDSITQSQVKNIKGLLKTLNTTTEEMEAVSKAGLGMLKFVEAVMGYCDVFREIKPKREKVARLERNFYLTKRELERIQNEL; Manufacturer approved use: IHC polyclonal rabbit AB_2676329 Atlas Antibodies HPA039065 2025-08-19 09:11:17 0
HES1-human
 
Resource Report
Resource Website
Rating or validation data
CDI Cat# R159.1.2C1, RRID:AB_2616000 HES1 Homo sapiens ENCODE PROJECT External validation DATA SET is released testing lot 20130115.RAP for not specified; status is not pursued unknown mouse AB_2616000 CDI R159.1.2C1 (also ENCAB000BEW) 2025-08-19 09:11:15 0
Anti-NCF2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA002327, RRID:AB_1079550 NCF2 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1079550 Atlas Antibodies HPA002327 2025-08-19 09:11:17 0
Anti-LMTK2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA010657, RRID:AB_1079259 LMTK2 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1079259 Atlas Antibodies HPA010657 2025-08-19 09:11:17 0
Anti-TOR3A polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA028766, RRID:AB_10602251 TOR3A human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10602251 Atlas Antibodies HPA028766 2025-08-19 09:12:03 0
Anti-FLYWCH1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA040753, RRID:AB_10794880 FLYWCH1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10794880 Atlas Antibodies HPA040753 2025-08-19 09:11:17 0
Anti-SP140 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA006162, RRID:AB_1857403 SP140 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1857403 Atlas Antibodies HPA006162 2025-08-19 09:11:17 2
Anti-PRND polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA043373, RRID:AB_2678450 PRND human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2678450 Atlas Antibodies HPA043373 2025-08-19 09:11:18 0
Anti-VIPR2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA062707, RRID:AB_2684842 VIPR2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2684842 Atlas Antibodies HPA062707 2025-08-19 09:11:18 0
Anti-HIC1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA043372, RRID:AB_10795614 HIC1 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10795614 Atlas Antibodies HPA043372 2025-08-19 09:12:04 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.