Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Rabbit anti-GTF2IRD/TFII-IRD1 Antibody, Affinity Purified
 
Resource Report
Resource Website
Discontinued
Rating or validation data
Bethyl Cat# A301-333A, RRID:AB_937890 GTF2IRD/TFII-IRD1 human Applications: WB, IP, IHC polyclonal rabbit AB_937890 Bethyl A301-333A (also A301-333A-T, A301-333A-M) 2025-08-19 09:00:10 0
Rabbit anti-ADNP Antibody, Affinity Purified
 
Resource Report
Resource Website
1+ mentions
Discontinued
Rating or validation data
Bethyl Cat# A300-104A, RRID:AB_242522 ADNP human Applications: WB, IHC polyclonal rabbit AB_242522 Bethyl A300-104A (also A300-104A-M, A300-104A-T) 2025-08-19 09:00:34 2
Anti-ATP12A polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA039526, RRID:AB_10673534 ATP12A human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence IYSVELSGTKDIVKTDKGDGKEKYRGLKNNCLELKKKNHKEEFQKELHLDDHKLSNRELEEKYGTDIIMGLSSTR; Manufacturer approved use: IHC, WB polyclonal rabbit AB_10673534 Atlas Antibodies HPA039526 2025-08-19 09:00:35 0
Anti-AP5M1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA057098, RRID:AB_2683335 AP5M1 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683335 Atlas Antibodies HPA057098 2025-08-19 09:00:36 0
Anti-SFTPD
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA056768, RRID:AB_2683232 SFTPD human unknown rabbit AB_2683232 Sigma-Aldrich HPA056768 2025-08-19 09:00:37 0
Anti-PCDH12 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA051242, RRID:AB_2681402 PCDH12 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2681402 Atlas Antibodies HPA051242 2025-08-19 09:00:13 0
Anti-ATAD2B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA034555, RRID:AB_10601665 ATAD2B human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10601665 Atlas Antibodies HPA034555 2025-08-19 09:00:12 0
Anti-FAM207A
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA036354, RRID:AB_10672242 FAM207A human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10672242 Atlas Antibodies HPA036354 2025-08-19 09:00:12 0
Anti-PRSS21 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA008477, RRID:AB_1079697 PRSS21 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1079697 Atlas Antibodies HPA008477 2025-08-19 09:00:35 0
Anti-CCDC142 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA056946, RRID:AB_2683282 CCDC142 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683282 Atlas Antibodies HPA056946 2025-08-19 09:00:13 0
Anti-ABCC8 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA042318, RRID:AB_2677947 ABCC8 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2677947 Atlas Antibodies HPA042318 2025-08-19 09:00:13 0
Anti-HEBP1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA075277, RRID:AB_2686741 HEBP1 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2686741 Atlas Antibodies HPA075277 2025-08-19 09:00:36 0
Anti-NFE2L2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA043438, RRID:AB_2678482 NFE2L2 human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2678482 Atlas Antibodies HPA043438 2025-08-19 09:00:13 0
Anti-DNAJB7 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA000534, RRID:AB_1078693 DNAJB7 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1078693 Atlas Antibodies HPA000534 2025-08-19 09:00:35 0
Anti-MRVI1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA008704, RRID:AB_1079413 MRVI1 human Originating manufacturer of this product. Applications: ICC-IF, IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1079413 Atlas Antibodies HPA008704 2025-08-19 09:00:12 0
Anti-PPME1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA043900, RRID:AB_2678722 PPME1 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2678722 Atlas Antibodies HPA043900 2025-08-19 09:00:35 0
Anti-FLNB
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA004886, RRID:AB_1848600 FLNB human Originating manufacturer of this product. Applications: IHC. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1848600 Atlas Antibodies HPA004886 2025-08-19 09:00:12 1
Anti-C3orf20 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA040049, RRID:AB_10795685 C3orf20 antibody produced in rabbit human polyclonal rabbit AB_10795685 Atlas Antibodies HPA040049 2025-08-19 09:00:38 0
Anti-SLC39A10 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA036513, RRID:AB_10670801 SLC39A10 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10670801 Atlas Antibodies HPA036513 2025-08-19 09:00:12 0
Anti-ARL11
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA040887, RRID:AB_10796229 ARL11 human Originating manufacturer of this product. Applications: IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10796229 Atlas Antibodies HPA040887 2025-08-19 09:00:35 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.