Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-CD40LG antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA045827, RRID:AB_10959606 CD40LG antibody produced in rabbit human Vendor recommendations: protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal AB_10959606 Sigma-Aldrich HPA045827 2025-08-20 12:27:21 0
Anti-STX16 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA042033, RRID:AB_10963935 STX16 antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable protein array: suitable polyclonal AB_10963935 Sigma-Aldrich HPA042033 2025-08-20 12:27:20 0
REPIN1-human
 
Resource Report
Resource Website
Rating or validation data
GeneTex Cat# GTX119143, RRID:AB_11162310 REPIN1 human ENCODE PROJECT External validation DATA SET is released testing lot 40774 for not specified; status is not pursued polyclonal rabbit AB_11162310 GeneTex GTX119143 2025-08-20 12:27:06 0
ABCF1-human
 
Resource Report
Resource Website
Rating or validation data
GeneTex Cat# GTX114228, RRID:AB_11172849 ABCF1 human ENCODE PROJECT External validation DATA SET is released testing lot 40660 for not specified; status is not pursued polyclonal rabbit AB_11172849 GeneTex GTX114228 2025-08-20 12:27:43 0
Anti-HIPK3 antibody produced in rabbit
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Sigma-Aldrich Cat# HPA028069, RRID:AB_10601815 HIPK3 antibody produced in rabbit human Vendor recommendations: Other; Immunohistochemistry; indirect immunofluorescence: suitable, protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal rabbit AB_10601815 Sigma-Aldrich HPA028069 2025-08-20 12:27:14 1
Anti-CDV3
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA029761, RRID:AB_10600193 CDV3 rat, mouse, human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_10600193 Atlas Antibodies HPA029761 2025-08-19 07:53:17 0
Anti-C8orf86 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA025066, RRID:AB_1848937 C8orf86 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1848937 Atlas Antibodies HPA025066 2025-08-19 07:53:17 0
Anti-KLHL12 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA071324, RRID:AB_2686389 KLHL12 human Originating manufacturer of this product. Applications: ICC-IF, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2686389 Atlas Antibodies HPA071324 2025-08-19 07:53:20 0
Anti-MMS19 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA056299, RRID:AB_2683091 MMS19 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683091 Atlas Antibodies HPA056299 2025-08-19 07:53:19 0
Anti-PALM2-AKAP2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA058905, RRID:AB_2683851 PALM2-AKAP2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2683851 Atlas Antibodies HPA058905 2025-08-19 07:53:15 0
Anti-ZNF189 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA034814, RRID:AB_10601030 ZNF189 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10601030 Atlas Antibodies HPA034814 2025-08-19 07:53:18 0
Anti-ATP6V1D
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA057316, RRID:AB_2683409 ATP6V1D human unknown rabbit AB_2683409 Sigma-Aldrich HPA057316 2025-08-19 07:53:21 0
Anti-SPATA45 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA049921, RRID:AB_2680953 SPATA45 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2680953 Atlas Antibodies HPA049921 2025-08-19 07:53:19 0
Anti-PRRC2B polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA064301, RRID:AB_2685237 PRRC2B human Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2685237 Atlas Antibodies HPA064301 2025-08-19 07:53:20 0
Anti-WNT6 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA052031, RRID:AB_2681701 WNT6 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRF; Manufacturer approved use: IHC polyclonal rabbit AB_2681701 Atlas Antibodies HPA052031 2025-08-19 07:53:14 0
Rabbit Anti-HDAC11 Polyclonal Antibody, Unconjugated
 
Resource Report
Resource Website
Rating or validation data
Bioss Cat# bs-2894R, RRID:AB_2615878 Rabbit HDAC11 rat, mouse, human manufacturer recommendations: IgG WB(1:100-500), ELISA(1:500-1000), IP(1:20-100), IHC-P(1:100-500), IHC-F(1:100-500), Flow-Cyt(1:20-100), IF(1:50-200); Western Blot; ELISA; Flow Cytometry; Immunohistochemistry; Immunoprecipitation; The following antibodies were determined to be duplicates and consolidated by curator on 11/2018: AB_10855094, AB_2615878. polyclonal rabbit AB_2615878 Bioss bs-2894R 2025-08-19 07:53:56 0
Tyrosinase-Related Protein-1
 
Resource Report
Resource Website
Rating or validation data
Leica Biosystems Cat# NCL-TRP-1, RRID:AB_564153 Prokaryotic recombinant fusion protein corresponding to th ec-terminus of the TRP-1 molecule Used By NYUIHC-571
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:TRUE, NonFunctional in animal:FALSE
monoclonal AB_564153 Leica Biosystems NCL-TRP-1 2025-08-19 07:54:23 0
Tat-SF1 Antibody
 
Resource Report
Resource Website
1+ mentions
Discontinued
Rating or validation data
Thermo Fisher Scientific Cat# A302-023A, RRID:AB_1576598 Tat-SF1 human Discontinued; Applications: IP (2-5 µg/mg lysate), WB (1:2,000-1:10,000) polyclonal rabbit AB_1576598 Thermo Fisher Scientific A302-023A 2025-08-19 07:54:35 1
Anti-CYB561A3
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA052548, RRID:AB_2681866 CYB561A3 human unknown rabbit AB_2681866 Sigma-Aldrich HPA052548 2025-08-19 07:54:35 0
Anti-RAB25 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA010872, RRID:AB_1079729 RAB25 human polyclonal rabbit AB_1079729 Atlas Antibodies HPA010872 2025-08-19 07:54:20 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.