Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10599302
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KGMDSEDDLRDEVEDAVQKVCNATGCSDFNLIVQNLEAENYNIESAIIAVLRMNQGKRNNAEENLEPSGRVLKQCGP; Manufacturer approved use: ICC-IF, IHC, WB
Host Organism: rabbit
Clonality: polyclonal
Target(s): OTUD3
Proper citation: Atlas Antibodies Cat# HPA028543, RRID:AB_10599302 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1227812
Comments: Applications: FC
Host Organism: mouse
Clonality: monoclonal
Target(s): TRA-1-60-R
Proper citation: BioLegend Cat# 330606, RRID:AB_1227812 Copy
http://antibodyregistry.org/AB_2107855
Comments: validation status unknown check with seller; recommendations: western blot, ELISA, immunoprecipitation, immunocytochemistry
Host Organism: mouse
Clonality: monoclonal
Target(s): Gab1
Proper citation: Santa Cruz Biotechnology Cat# sc-133191, RRID:AB_2107855 Copy
http://antibodyregistry.org/AB_1227504
Comments: Applications: FC
Host Organism: mouse
Clonality: monoclonal
Target(s): CD107a
Proper citation: BioLegend Cat# 328610, RRID:AB_1227504 Copy
http://antibodyregistry.org/AB_1186040
Comments: Applications: FC
Host Organism: mouse
Clonality: monoclonal
Target(s): CD107a
Proper citation: BioLegend Cat# 328608, RRID:AB_1186040 Copy
http://antibodyregistry.org/AB_2065309
Comments: validation status unknown, seller recommendations provided in 2012:immunohistochemistry, immunocytochemistry
Host Organism: rabbit
Clonality: monoclonal
Target(s): BCAM
Proper citation: Abcam Cat# 2994-1, RRID:AB_2065309 Copy
http://antibodyregistry.org/AB_2631042
Host Organism: rabbit
Clonality: polyclonal
Target(s): SERCA2a
Proper citation: Badrilla Cat# A010-20, RRID:AB_2631042 Copy
http://antibodyregistry.org/AB_2315544
Clonality: unknown
Proper citation: H. Aberle, Max-Planck-Institute for Developmental Biology; Baden-Württemberg; Germany Cat# vGluT (Drosophila vesicular glutamate transporter), RRID:AB_2315544 Copy
http://antibodyregistry.org/AB_2887981
Comments: Applications: WB, ICC/IF, IHC-P, FACS, ELISA
Host Organism: mouse
Clonality: monoclonal
Proper citation: GeneTex Cat# GTX60577, RRID:AB_2887981 Copy
http://antibodyregistry.org/AB_312911
Comments: Applications: FC
Host Organism: rat
Clonality: monoclonal
Target(s): CD31
Proper citation: BioLegend Cat# 102504, RRID:AB_312911 Copy
http://antibodyregistry.org/AB_393549
Comments: Intracellular staining (flow Cytotoxicityometry)
Host Organism: mouse
Clonality: monoclonal
Target(s): MIP-1 beta
Proper citation: BD Biosciences Cat# 550078, RRID:AB_393549 Copy
http://antibodyregistry.org/AB_2630386
Host Organism: rabbit
Clonality: polyclonal
Target(s): plasma membrane calcium ATPase isoform 2 (PMCA2)
Proper citation: Peter Barr-Gillespie - Oregon Health and Science University Cat# Barr-Gillespie_PMCA2, RRID:AB_2630386 Copy
http://antibodyregistry.org/AB_2116167
Comments: seller recommendations: Western Blot; Western Blotting
Host Organism: rabbit
Clonality: polyclonal
Target(s): mGluR2
Proper citation: Millipore Cat# 07-261, RRID:AB_2116167 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2686301
Comments: Originating manufacturer of this product. Applications: ICC-IF. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality: polyclonal
Target(s): SYF2
Proper citation: Atlas Antibodies Cat# HPA070710, RRID:AB_2686301 Copy
http://antibodyregistry.org/AB_2920560
Comments: Applications: WB
Host Organism: mouse
Clonality: monoclonal
Target(s): α-Tubulin
Proper citation: Tianjin Sungene Biotech Cat# KM9007, RRID:AB_2920560 Copy
Discontinued
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_2620299
Comments: Applications: WB, IP, IHC
Host Organism: rabbit
Clonality: polyclonal
Target(s): SF3B4
Proper citation: Bethyl Cat# A303-950A, RRID:AB_2620299 Copy
http://antibodyregistry.org/AB_2757817
Host Organism: mouse
Clonality: unknown
Target(s): C-Peptide
Proper citation: Siemens Cat# LKPEP1, RRID:AB_2757817 Copy
Discontinued
http://antibodyregistry.org/AB_2659926
Comments: Discontinued: 7-2019; Target Distribution B cells, basophils, dendritic cells, granulocytes, hematopoietic stem cells, Langerhans cells, leukocytes, lymphocytes, macrophages, mast cells, monocytes, plasma cells, T cells, thymocytes; target type CD markers; tested applications MACS Flow Cytometry; quantity:9 µg in 300 µL
Host Organism: rat
Clonality: monoclonal
Target(s): CD45
Proper citation: Miltenyi Biotec Cat# 130-102-776, RRID:AB_2659926 Copy
http://antibodyregistry.org/AB_2935477
Comments: Applications: WB, IHC, IF, ELISA
Host Organism: rabbit
Clonality: polyclonal
Target(s): Claudin 5
Proper citation: Proteintech Cat# 29767-1-AP, RRID:AB_2935477 Copy
http://antibodyregistry.org/AB_2794291
Comments: Original manufacturer of this product; ISO 9001:2015
Host Organism: goat
Clonality: unknown
Target(s): IgG
Proper citation: SouthernBiotech Cat# 1030-02, RRID:AB_2794291 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.