Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

3,187,264 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Rabbit Anti-CD282 / TLR2 Antibody, Unconjugated
 
Resource Report
Resource Website
Acris Antibodies Cat# AP09340PU-N, RRID:AB_2035301 CD282 / TLR2 mouse, human manufacturer recommendations: ELISA; Immunohistochemistry; Western Blot; ELISA, Paraffin sections, Western Blot unknown rabbit AB_2035301 Acris Antibodies AP09340PU-N 2025-08-19 10:31:55 0
Anti-CFAP77 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA024647, RRID:AB_10601126 CFAP77 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SSAVQKVIPSLAGHHIKGGPQAELGKPRERSYSLPGINFNYGLYIRGLDGGVPEAIGRWNVFKQQPTCPHELTRNYIAMN; Manufacturer approved use: IHC polyclonal rabbit AB_10601126 Atlas Antibodies HPA024647 2025-08-19 10:32:11 0
Rabbit Anti-ErbB-2 (Her-2), phospho (Tyr1248) Polyclonal Antibody, Unconjugated
 
Resource Report
Resource Website
AnaSpec; EGT Group Cat# 29607-025, RRID:AB_1091590 ErbB-2 (Her-2), phospho (Tyr1248) mouse, human manufacturer recommendations: ELISA; Immunohistochemistry; Western Blot; Immunohistochemistry, Western Blot, ELISA polyclonal rabbit AB_1091590 AnaSpec; EGT Group 29607-025 2025-08-19 10:31:50 0
Anti-CMC2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA006871, RRID:AB_1845581 CMC2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1845581 Atlas Antibodies HPA006871 2025-08-19 10:32:11 0
CD45RC
 
Resource Report
Resource Website
BD Biosciences Cat# 746515, RRID:AB_2743812 CD45RC mouse DNL-1.9 Applications: Flow cytometry monoclonal rat AB_2743812 BD Biosciences 746515 2025-08-19 10:32:13 0
Anti-SLC22A17 Antibody
 
Resource Report
Resource Website
Antibodies.com Cat# A82727, RRID:AB_2747989 SLC22A17 human Applications: ELISA, IHC unknown goat AB_2747989 Antibodies.com A82727 2025-08-19 10:32:16 0
MOB4 Polyclonal Antibody
 
Resource Report
Resource Website
ABclonal Cat# A4590, RRID:AB_2765772 MOB4 rat, mouse, human Applications:WB polyclonal rabbit AB_2765772 ABclonal A4590 2025-08-19 10:32:19 0
Rabbit Anti-Human Human IgE Polyclonal, Unconjugated
 
Resource Report
Resource Website
LSBio (LifeSpan) Cat# LS-C68500-250, RRID:AB_1652990 Human Human IgE human vendor suggested use: Immunohistochemistry; Immunohistochemistry (Parrafin) polyclonal rabbit AB_1652990 LSBio (LifeSpan) LS-C68500-250 2025-08-19 10:31:51 0
Anti-PRKDC / DNA-PKcs
 
Resource Report
Resource Website
LSBio (LifeSpan) Cat# LS-C88130-100, RRID:AB_1807050 PRKDC / DNA-PKcs rat, human vendor suggested use: IgG1; IgG1 IF, IHC-P (1:50 - 1:100), IP (1:50 - 1:100, 1 - 2 µg/ml), WB (1:50 - 1:100, 1 - 2 µg/ml); Western Blot; Immunohistochemistry - fixed; Immunofluorescence; Immunohistochemistry; Immunoprecipitation monoclonal mouse AB_1807050 LSBio (LifeSpan) LS-C88130-100 2025-08-19 10:32:19 0
DECR2 Antibody
 
Resource Report
Resource Website
Novus Cat# H00026063-B01P, RRID:AB_2091416 DECR2 Human, Rat Applications: Western Blot polyclonal Mouse AB_2091416 Novus H00026063-B01P 2025-08-19 10:32:10 0
Cytokeratin 6 (A-12)
 
Resource Report
Resource Website
Discontinued
Santa Cruz Biotechnology Cat# sc-22479, RRID:AB_2249760 Cytokeratin 6 (A-12) rat, mouse, rabbit, human Discontinued: 2016; validation status unknown check with seller; recommendations: Immunofluorescence; ELISA; Immunocytochemistry; WB, IF, ELISA; Western Blot polyclonal goat AB_2249760 Santa Cruz Biotechnology sc-22479 2025-08-19 10:32:09 0
Mouse Anti-NHLH1 Purified - MaxPab Polyclonal Antibody, Unconjugated
 
Resource Report
Resource Website
Abnova Cat# H00004807-B01P, RRID:AB_1677902 NHLH1 manufacturer recommendations: Other; Western Blot; Detection Antibody, Western Blot (Transfected Lysate) polyclonal mouse AB_1677902 Abnova H00004807-B01P 2025-08-19 10:31:54 0
ZNF300 Antibody
 
Resource Report
Resource Website
Abbiotec Cat# 250541, RRID:AB_2304710 ZNF300 rat, h, m, mouse, r, human manufacturer recommendations: IgG Immunohistochemistry; Western Blot; ELISA; E, WB, IHC polyclonal rabbit AB_2304710 Abbiotec 250541 2025-08-19 10:31:52 0
HLA-DRB5 MaxPab mouse polyclonal antibody (B02)
 
Resource Report
Resource Website
Abnova Cat# H00003127-B02, RRID:AB_1204479 HLA-DRB5 MaxPab mouse polyclonal antibody (B02) human manufacturer recommendations: Det Ab,WB-Tr; Western Blot polyclonal mouse AB_1204479 Abnova H00003127-B02 2025-08-19 10:31:55 0
Id1 (N-16)
 
Resource Report
Resource Website
Discontinued
Santa Cruz Biotechnology Cat# sc-27186, RRID:AB_648727 Id1 (N-16) rat, mouse, human Discontinued: 2016; validation status unknown check with seller; recommendations: Western Blot; Immunofluorescence; ELISA; WB, IF, ELISA polyclonal goat AB_648727 Santa Cruz Biotechnology sc-27186 2025-08-19 10:32:10 0
XCL1 antibody
 
Resource Report
Resource Website
Biorbyt Cat# orb20377, RRID:AB_10751666 XCL1 antibody human manufacturer recommendations: IgG ELISA; ELISA polyclonal goat AB_10751666 Biorbyt orb20377 2025-08-19 10:32:19 0
Rabbit Anti-Mouse Focal Adhesion Kinase 1 (PTK2, FAK1) Polyclonal, Unconjugated
 
Resource Report
Resource Website
LSBio (LifeSpan) Cat# LS-C41215-50, RRID:AB_1192027 Mouse Focal Adhesion Kinase 1 (PTK2, FAK1) mouse, human vendor suggested use: Western Blot; Western Blot polyclonal rabbit AB_1192027 LSBio (LifeSpan) LS-C41215-50 2025-08-19 10:32:11 0
Rabbit Anti-Gclc Polyclonal Antibody
 
Resource Report
Resource Website
Discontinued
Creative Biomart Cat# DPABT-H10262, RRID:AB_11393058 Gclc human Discontinued: 2015; Discontinued on 27 July 2015; IHC-P polyclonal rabbit AB_11393058 Creative Biomart DPABT-H10262 2025-08-19 10:32:14 0
Mouse Anti-C18orf15 Polyclonal Antibody, Unconjugated
 
Resource Report
Resource Website
Primm Biotech Cat# Ab-1478-YOM, RRID:AB_10804855 Mouse C18orf15 functionality unknown, check validation data for this product with vendor polyclonal mouse AB_10804855 Primm Biotech Ab-1478-YOM 2025-08-19 10:32:12 0
FOS antibody
 
Resource Report
Resource Website
Biorbyt Cat# orb10666, RRID:AB_10767713 FOS antibody rat, mouse, human manufacturer recommendations: IgG ELISA, WB; Western Blot; ELISA polyclonal rabbit AB_10767713 Biorbyt orb10666 2025-08-19 10:32:15 0

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.