Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

On page 127 showing 2521 ~ 2540 out of 3,187,264 results
Snippet view Table view Download Top 1000 Results
Click the to add this resource to an Authentication Report or Collection

http://antibodyregistry.org/AB_2035301

Comments: manufacturer recommendations: ELISA; Immunohistochemistry; Western Blot; ELISA, Paraffin sections, Western Blot
Host Organism: rabbit
Clonality unknown
Target(s): CD282 / TLR2

Proper citation: Acris Antibodies Cat# AP09340PU-N, RRID:AB_2035301 Copy   


Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_10601126

Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence SSAVQKVIPSLAGHHIKGGPQAELGKPRERSYSLPGINFNYGLYIRGLDGGVPEAIGRWNVFKQQPTCPHELTRNYIAMN; Manufacturer approved use: IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): CFAP77

Proper citation: Atlas Antibodies Cat# HPA024647, RRID:AB_10601126 Copy   


http://antibodyregistry.org/AB_1091590

Comments: manufacturer recommendations: ELISA; Immunohistochemistry; Western Blot; Immunohistochemistry, Western Blot, ELISA
Host Organism: rabbit
Clonality polyclonal
Target(s): ErbB-2 (Her-2), phospho (Tyr1248)

Proper citation: AnaSpec; EGT Group Cat# 29607-025, RRID:AB_1091590 Copy   


  • RRID:AB_1845581

Ratings or validation data are available for this resource

http://antibodyregistry.org/AB_1845581

Comments: Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST).
Host Organism: rabbit
Clonality polyclonal
Target(s): CMC2

Proper citation: Atlas Antibodies Cat# HPA006871, RRID:AB_1845581 Copy   


  • RRID:AB_2743812

http://antibodyregistry.org/AB_2743812

Comments: Applications: Flow cytometry
Host Organism: rat
Clonality monoclonal
Target(s): CD45RC

Proper citation: BD Biosciences Cat# 746515, RRID:AB_2743812 Copy   


  • RRID:AB_2747989

http://antibodyregistry.org/AB_2747989

Comments: Applications: ELISA, IHC
Host Organism: goat
Clonality unknown
Target(s): SLC22A17

Proper citation: Antibodies.com Cat# A82727, RRID:AB_2747989 Copy   


  • RRID:AB_2765772

http://antibodyregistry.org/AB_2765772

Comments: Applications:WB
Host Organism: rabbit
Clonality polyclonal
Target(s): MOB4

Proper citation: ABclonal Cat# A4590, RRID:AB_2765772 Copy   


http://antibodyregistry.org/AB_1652990

Comments: vendor suggested use: Immunohistochemistry; Immunohistochemistry (Parrafin)
Host Organism: rabbit
Clonality polyclonal
Target(s): Human Human IgE

Proper citation: LSBio (LifeSpan) Cat# LS-C68500-250, RRID:AB_1652990 Copy   


  • RRID:AB_1807050

http://antibodyregistry.org/AB_1807050

Comments: vendor suggested use: IgG1; IgG1 IF, IHC-P (1:50 - 1:100), IP (1:50 - 1:100, 1 - 2 µg/ml), WB (1:50 - 1:100, 1 - 2 µg/ml); Western Blot; Immunohistochemistry - fixed; Immunofluorescence; Immunohistochemistry; Immunoprecipitation
Host Organism: mouse
Clonality monoclonal
Target(s): PRKDC / DNA-PKcs

Proper citation: LSBio (LifeSpan) Cat# LS-C88130-100, RRID:AB_1807050 Copy   


  • RRID:AB_2091416

http://antibodyregistry.org/AB_2091416

Comments: Applications: Western Blot
Host Organism: Mouse
Clonality polyclonal
Target(s): DECR2

Proper citation: Novus Cat# H00026063-B01P, RRID:AB_2091416 Copy   


  • RRID:AB_2249760

Discontinued

http://antibodyregistry.org/AB_2249760

Comments: Discontinued: 2016; validation status unknown check with seller; recommendations: Immunofluorescence; ELISA; Immunocytochemistry; WB, IF, ELISA; Western Blot
Host Organism: goat
Clonality polyclonal
Target(s): Cytokeratin 6 (A-12)

Proper citation: Santa Cruz Biotechnology Cat# sc-22479, RRID:AB_2249760 Copy   


http://antibodyregistry.org/AB_1677902

Comments: manufacturer recommendations: Other; Western Blot; Detection Antibody, Western Blot (Transfected Lysate)
Host Organism: mouse
Clonality polyclonal
Target(s): NHLH1

Proper citation: Abnova Cat# H00004807-B01P, RRID:AB_1677902 Copy   


  • RRID:AB_2304710

http://antibodyregistry.org/AB_2304710

Comments: manufacturer recommendations: IgG Immunohistochemistry; Western Blot; ELISA; E, WB, IHC
Host Organism: rabbit
Clonality polyclonal
Target(s): ZNF300

Proper citation: Abbiotec Cat# 250541, RRID:AB_2304710 Copy   


http://antibodyregistry.org/AB_1204479

Comments: manufacturer recommendations: Det Ab,WB-Tr; Western Blot
Host Organism: mouse
Clonality polyclonal
Target(s): HLA-DRB5 MaxPab mouse polyclonal antibody (B02)

Proper citation: Abnova Cat# H00003127-B02, RRID:AB_1204479 Copy   


  • RRID:AB_648727

Discontinued

http://antibodyregistry.org/AB_648727

Comments: Discontinued: 2016; validation status unknown check with seller; recommendations: Western Blot; Immunofluorescence; ELISA; WB, IF, ELISA
Host Organism: goat
Clonality polyclonal
Target(s): Id1 (N-16)

Proper citation: Santa Cruz Biotechnology Cat# sc-27186, RRID:AB_648727 Copy   


  • RRID:AB_10751666

http://antibodyregistry.org/AB_10751666

Comments: manufacturer recommendations: IgG ELISA; ELISA
Host Organism: goat
Clonality polyclonal
Target(s): XCL1 antibody

Proper citation: Biorbyt Cat# orb20377, RRID:AB_10751666 Copy   


http://antibodyregistry.org/AB_1192027

Comments: vendor suggested use: Western Blot; Western Blot
Host Organism: rabbit
Clonality polyclonal
Target(s): Mouse Focal Adhesion Kinase 1 (PTK2, FAK1)

Proper citation: LSBio (LifeSpan) Cat# LS-C41215-50, RRID:AB_1192027 Copy   


Discontinued

http://antibodyregistry.org/AB_11393058

Comments: Discontinued: 2015; Discontinued on 27 July 2015; IHC-P
Host Organism: rabbit
Clonality polyclonal
Target(s): Gclc

Proper citation: Creative Biomart Cat# DPABT-H10262, RRID:AB_11393058 Copy   


http://antibodyregistry.org/AB_10804855

Comments: functionality unknown, check validation data for this product with vendor
Host Organism: mouse
Clonality polyclonal
Target(s): Mouse C18orf15

Proper citation: Primm Biotech Cat# Ab-1478-YOM, RRID:AB_10804855 Copy   


  • RRID:AB_10767713

http://antibodyregistry.org/AB_10767713

Comments: manufacturer recommendations: IgG ELISA, WB; Western Blot; ELISA
Host Organism: rabbit
Clonality polyclonal
Target(s): FOS antibody

Proper citation: Biorbyt Cat# orb10666, RRID:AB_10767713 Copy   



Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Save Your Search

    You can save any searches you perform for quick access to later from here.

  6. Query Expansion

    We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.

  7. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  8. Sources

    Here are the sources that were queried against in your search that you can investigate further.

  9. Categories

    Here are the categories present within dkNET that you can filter your data on

  10. Subcategories

    Here are the subcategories present within this category that you can filter your data on

  11. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.

X