Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Validation:information available (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

55,392 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
Anti-HEATR2 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA020243, RRID:AB_1848750 Human HEATR2 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1848750 Sigma-Aldrich HPA020243 2025-08-19 11:02:20 0
Anti-KAT5 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA016953, RRID:AB_1851277 Human KAT5 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1851277 Sigma-Aldrich HPA016953 2025-08-19 11:02:20 0
Anti-IGFBP6 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA008005, RRID:AB_1851499 Human IGFBP6 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1851499 Sigma-Aldrich HPA008005 2025-08-19 11:02:50 0
Anti-PPP1R8 antibody produced in rabbit
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Sigma-Aldrich Cat# HPA027452, RRID:AB_1854490 Human PPP1R8 human Vendor recommendations: Immunohistochemistry; Other; Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1854490 Sigma-Aldrich HPA027452 2025-08-19 11:02:21 3
Anti-SYNJ1 antibody produced in rabbit
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Sigma-Aldrich Cat# HPA011916, RRID:AB_1857692 SYNJ1 antibody produced in rabbit human Vendor recommendations: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable; Immunohistochemistry; Immunofluorescence; Western Blot; Other polyclonal rabbit AB_1857692 Sigma-Aldrich HPA011916 2025-08-19 11:02:30 2
Anti-PDE1A antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA022151, RRID:AB_1855118 PDE1A antibody produced in rabbit human Vendor recommendations: Other; Immunohistochemistry; protein array: suitable, immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable polyclonal rabbit AB_1855118 Sigma-Aldrich HPA022151 2025-08-19 11:02:54 0
Anti-TMEM140 antibody produced in rabbit
 
Resource Report
Resource Website
Rating or validation data
Sigma-Aldrich Cat# HPA016871, RRID:AB_1858091 Human TMEM140 human Vendor recommendations: Immunohistochemistry; Other; Western Blot; Immunoblotting, Immunohistochemistry (formalin-fixed, paraffin-embedded sections), Protein Array unknown rabbit AB_1858091 Sigma-Aldrich HPA016871 2025-08-19 11:02:53 0
Peroxiredoxin 6 antibody [EPR3755]
 
Resource Report
Resource Website
Rating or validation data
Abcam Cat# ab92322, RRID:AB_10562487 Peroxiredoxin 6 antibody [EPR3755] rat, mouse, human Applications: Immunohistochemistry, Immunoprecipitation, Immunocytochemistry, Western Blot, Immunofluorescence, Immunohistochemistry - fixed, ICC/IF, IHC-P, IP, WB
Validation: data for WB is available from YCharOS. https://doi.org/10.5281/zenodo.4730953
monoclonal rabbit AB_10562487 Abcam ab92322 2025-08-19 11:03:00 0
Anti-MYO1G polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA021252, RRID:AB_1854254 MYO1G human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1854254 Atlas Antibodies HPA021252 2025-08-19 11:03:24 0
Anti-IDO1
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA023149, RRID:AB_1846221 IDO1 human Originating manufacturer of this product. Applications: IHC, WB. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1846221 Atlas Antibodies HPA023149 2025-08-19 11:03:24 2
Anti-MPP3
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA024742, RRID:AB_1854087 MPP3 human Originating manufacturer of this product. Applications: ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). unknown rabbit AB_1854087 Atlas Antibodies HPA024742 2025-08-19 11:03:25 0
Anti-CRISPLD2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA030055, RRID:AB_10611821 CRISPLD2 human Originating manufacturer of this product. Applications: IHC, WB. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10611821 Atlas Antibodies HPA030055 2025-08-19 11:03:35 0
Anti-FMNL3 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA023201, RRID:AB_1848575 FMNL3 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1848575 Atlas Antibodies HPA023201 2025-08-19 11:03:35 0
Anti-KLF15 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA028866, RRID:AB_10600819 KLF15 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence PVPVKQESGTGPASPGQAPENVKVAQLLVNIQGQTFALVPQVVPSSNLNLPSKFVRIAPVPIAAKPVGSGPLGPGPAGLLMGQKFPKNPAAELIKMHKCTFPG; Manufacturer approved use: IHC polyclonal rabbit AB_10600819 Atlas Antibodies HPA028866 2025-08-19 11:03:35 0
Anti-FADS2 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA006741, RRID:AB_1078796 FADS2 human Originating manufacturer of this product. Applications: IHC. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_1078796 Atlas Antibodies HPA006741 2025-08-19 11:03:24 0
Anti-SLITRK4 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA000431, RRID:AB_2665991 SLITRK4 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2665991 Atlas Antibodies HPA000431 2025-08-19 11:03:34 0
Anti-CRISP1 polyclonal antibody
 
Resource Report
Resource Website
Rating or validation data
Atlas Antibodies Cat# HPA028445, RRID:AB_10670428 CRISP1 human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_10670428 Atlas Antibodies HPA028445 2025-08-19 11:03:35 0
ZNF295 Antibody
 
Resource Report
Resource Website
Discontinued
Rating or validation data
Thermo Fisher Scientific Cat# A301-528A, RRID:AB_999692 ZNF295 human Discontinued; Applications: IP (2-5 µg/mg lysate), IHC (1:250-1:2,000), IF (1:250-1:2,000) polyclonal rabbit AB_999692 Thermo Fisher Scientific A301-528A (also A301-528A-T) 2025-08-19 11:03:41 0
Anti-PGP9.5
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Agilent Cat# Z5116, RRID:AB_2622233 PGP9.5 bovine Purified PGP 9.5 isolated from bovine brain used as immunogen. Original Manufacturer: Dako. Now part of Agilent. polyclonal rabbit AB_2622233 Agilent Z5116 2025-08-19 11:17:55 5
Anti-CD8A polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA037756, RRID:AB_2675648 CD8A human Originating manufacturer of this product. Applications: IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. Immunogen: Recombinant Protein Epitope Signature Tag (PrEST). polyclonal rabbit AB_2675648 Atlas Antibodies HPA037756 2025-08-19 11:17:55 1

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.