Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.
http://antibodyregistry.org/AB_2291533
Comments: Applications: Flow Cytometry
Host Organism: Rat
Clonality: monoclonal
Target(s): P-Cadherin
Proper citation: R and D Systems Cat# FAB761P, RRID:AB_2291533 Copy
http://antibodyregistry.org/AB_2066074
Comments: validation status unknown, seller recommendations provided in 2012: Immunocytochemistry; Immunofluorescence; Western Blot; Immunohistochemistry - fixed; Immunohistochemistry; Immunoprecipitation; ICC, ICC/IF, IHC-P, IP, WB
Host Organism: mouse
Clonality: monoclonal
Target(s): BubR1 antibody [8G1]
Proper citation: Abcam Cat# ab4637, RRID:AB_2066074 Copy
Discontinued
http://antibodyregistry.org/AB_677310
Comments: Discontinued: 2016; validation status unknown check with seller; recommendations: ELISA; Immunoprecipitation; Western Blot; Immunofluorescence; WB, IP, IF, ELISA
Host Organism: goat
Clonality: polyclonal
Target(s): Nup96 (C-20)
Proper citation: Santa Cruz Biotechnology Cat# sc-27400, RRID:AB_677310 Copy
Discontinued
http://antibodyregistry.org/AB_2211262
Comments: Discontinued: 2016; validation status unknown check with seller; recommendations: WB, IP, IF, IHC(P), ELISA; Immunofluorescence; ELISA; Immunohistochemistry; Immunoprecipitation; Western Blot; Immunocytochemistry
Host Organism: goat
Clonality: polyclonal
Target(s): gamma Tubulin (C-20)
Proper citation: Santa Cruz Biotechnology Cat# sc-7396, RRID:AB_2211262 Copy
http://antibodyregistry.org/AB_396562
Comments: Applications: Western blot, Immunohistochemistry-frozen
Host Organism: mouse
Clonality: monoclonal
Target(s): TIE2 (CD202b)
Proper citation: BD Biosciences Cat# 557039, RRID:AB_396562 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1845406
Comments: Vendor recommendations: Immunohistochemistry; Immunofluorescence; Western Blot; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable
Host Organism: rabbit
Clonality: polyclonal
Target(s): BNIP3L antibody produced in rabbit
Proper citation: Sigma-Aldrich Cat# HPA015652, RRID:AB_1845406 Copy
http://antibodyregistry.org/AB_2298971
Comments: Applications: W, IP, IHC-P, IF-IC. Consolidation on 11/2018: AB_10363754, AB_2156885, AB_2298971.
Host Organism: rabbit
Clonality: monoclonal
Target(s): Asymmetric-Methyl-PABP1 (Arg455/Arg460) (C60A10) Rabbit mAb
Proper citation: Cell Signaling Technology Cat# 3505, RRID:AB_2298971 Copy
http://antibodyregistry.org/AB_11043137
Comments: Applications: Flow, ICC/IF
Host Organism: rat
Clonality: monoclonal
Target(s): CD324 (E-Cadherin)
Proper citation: Thermo Fisher Scientific Cat# 50-3249-80, RRID:AB_11043137 Copy
http://antibodyregistry.org/AB_11042790
Comments: vendor suggested use: IgG; IgG ELISA (1:20000), IHC-P (2 µg/ml), WB (1:500); Western Blot; Immunohistochemistry - fixed; Immunohistochemistry; ELISA
Host Organism: rabbit
Clonality: polyclonal
Target(s): ATF4
Proper citation: LSBio (LifeSpan) Cat# LS-B6361-50, RRID:AB_11042790 Copy
http://antibodyregistry.org/AB_1272006
Comments: Applications: Flow (Assay-Dependent), Ctrl (Assay-Dependent)
Host Organism: mouse
Clonality: isotype control
Target(s): Mouse IgG2a kappa
Proper citation: Thermo Fisher Scientific Cat# 48-4724-82, RRID:AB_1272006 Copy
http://antibodyregistry.org/AB_11001827
Comments: Applications: ICC
Validation status: IF or IB (Pass), IB in brain (ND), IHC in brain (ND), KO (ND)
This clone is associated with these products: purified (Antibodies Incorporated, Cat# 75-280, RRID:AB_11001827), supernatant (Antibodies Incorporated, Cat# 73-280, RRID:AB_11030251), hybridoma (UC Davis/NIH NeuroMab Facility, Cat# N312/10, RRID:AB_2877552)
Host Organism: mouse
Clonality: monoclonal
Target(s): NSD1
Proper citation: Antibodies Incorporated Cat# 75-280, RRID:AB_11001827 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_304066
Comments: validation status unknown, seller recommendations provided in 2012: ELISA, IHC-Fr, IHC-P, sELISA, WB; ELISA; Immunohistochemistry - frozen; Immunohistochemistry - fixed; Western Blot; Immunohistochemistry
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
Host Organism: mouse
Clonality: monoclonal
Target(s): Aggrecan ARGxx antibody [BC-3]
Proper citation: Abcam Cat# ab3773, RRID:AB_304066 Copy
http://antibodyregistry.org/AB_11154032
Comments: Applications: Flow cytometry
Host Organism: mouse
Clonality: monoclonal
Target(s): CD28
Proper citation: BD Biosciences Cat# 561368, RRID:AB_11154032 Copy
http://antibodyregistry.org/AB_11153500
Comments: Applications: Flow cytometry
Host Organism: armenian hamster
Clonality: monoclonal
Target(s): CD183 (CXCR3)
Proper citation: BD Biosciences Cat# 562266, RRID:AB_11153500 Copy
http://antibodyregistry.org/AB_3095412
Comments: Applications: Flow Cyt (Intra), WB, IHC-P, ICC/IF, IP
Host Organism: Rabbit
Clonality: recombinant monoclonal
Target(s): TOMM40
Proper citation: Abcam Cat# ab185543, RRID:AB_3095412 Copy
http://antibodyregistry.org/AB_10597100
Comments: Originating manufacturer of this product.
Applications: IHC, IF, ELISA
Host Organism: rabbit
Clonality: polyclonal
Target(s): INS
Proper citation: Proteintech Cat# 15848-1-AP, RRID:AB_10597100 Copy
Discontinued
http://antibodyregistry.org/AB_10839702
Comments: Discontinued: 11-2018; Target Distribution B cells, dendritic cells, endothelial cells, Langerhans cells, monocytes, T cells; target type CD markers; tested applications MACS Flow Cytometry; quantity:
Info: This product is discontinued and reformatted to a higher concentration for optimized use in multicolor flow cytometry panels. The replacement product cat # is 130-113-572. (RRID:AB_2733843).
Host Organism: mouse
Clonality: monoclonal
Target(s): CD86
Proper citation: Miltenyi Biotec Cat# 130-094-877, RRID:AB_10839702 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_10599302
Comments: Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KGMDSEDDLRDEVEDAVQKVCNATGCSDFNLIVQNLEAENYNIESAIIAVLRMNQGKRNNAEENLEPSGRVLKQCGP; Manufacturer approved use: ICC-IF, IHC, WB
Host Organism: rabbit
Clonality: polyclonal
Target(s): OTUD3
Proper citation: Atlas Antibodies Cat# HPA028543, RRID:AB_10599302 Copy
Ratings or validation data are available for this resource
http://antibodyregistry.org/AB_1227812
Comments: Applications: FC
Host Organism: mouse
Clonality: monoclonal
Target(s): TRA-1-60-R
Proper citation: BioLegend Cat# 330606, RRID:AB_1227812 Copy
http://antibodyregistry.org/AB_2107855
Comments: validation status unknown check with seller; recommendations: western blot, ELISA, immunoprecipitation, immunocytochemistry
Host Organism: mouse
Clonality: monoclonal
Target(s): Gab1
Proper citation: Santa Cruz Biotechnology Cat# sc-133191, RRID:AB_2107855 Copy
Can't find your Antibody?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.