Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes

Preparing word cloud

×

The Antibody Registry is the authoritative source for antibody identifiers, which can be used in publications to uniquely mark the antibodies used in a paper.

Suggested Search Criteria

Enter extra filters to help narrow your search

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Mentions:yes (facet)

Facets


Recent searches

Snippet view Table view
Click the to add this resource to an Authentication Report or Collection

141,649 Results - per page

Show More Columns | Download Top 1000 Results

Antibody Name Proper Citation Target Antigen Target Organism Clone ID Defining Citation Comments Clonality Host Organism Antibody ID Vendor Catalog Number Record Last Update Mentions Count
BubR1 antibody [8G1]
 
Resource Report
Resource Website
1+ mentions
Abcam Cat# ab4637, RRID:AB_2066074 BubR1 antibody [8G1] human validation status unknown, seller recommendations provided in 2012: Immunocytochemistry; Immunofluorescence; Western Blot; Immunohistochemistry - fixed; Immunohistochemistry; Immunoprecipitation; ICC, ICC/IF, IHC-P, IP, WB monoclonal mouse AB_2066074 Abcam ab4637 2025-08-19 09:28:50 1
Nup96 (C-20)
 
Resource Report
Resource Website
1+ mentions
Discontinued
Santa Cruz Biotechnology Cat# sc-27400, RRID:AB_677310 Nup96 (C-20) rat, mouse, human Discontinued: 2016; validation status unknown check with seller; recommendations: ELISA; Immunoprecipitation; Western Blot; Immunofluorescence; WB, IP, IF, ELISA polyclonal goat AB_677310 Santa Cruz Biotechnology sc-27400 2025-08-19 09:28:55 1
gamma Tubulin (C-20)
 
Resource Report
Resource Website
1+ mentions
Discontinued
Santa Cruz Biotechnology Cat# sc-7396, RRID:AB_2211262 gamma Tubulin (C-20) rat, mouse, human Discontinued: 2016; validation status unknown check with seller; recommendations: WB, IP, IF, IHC(P), ELISA; Immunofluorescence; ELISA; Immunohistochemistry; Immunoprecipitation; Western Blot; Immunocytochemistry polyclonal goat AB_2211262 Santa Cruz Biotechnology sc-7396 2025-08-19 09:29:33 7
TIE2
 
Resource Report
Resource Website
1+ mentions
BD Biosciences Cat# 557039, RRID:AB_396562 TIE2 (CD202b) mouse, human Applications: Western blot, Immunohistochemistry-frozen monoclonal mouse AB_396562 BD Biosciences 557039 2025-08-19 09:28:53 1
Anti-BNIP3L antibody produced in rabbit
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Sigma-Aldrich Cat# HPA015652, RRID:AB_1845406 BNIP3L antibody produced in rabbit human Vendor recommendations: Immunohistochemistry; Immunofluorescence; Western Blot; Other; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable, protein array: suitable, immunoblotting: suitable polyclonal rabbit AB_1845406 Sigma-Aldrich HPA015652 2025-08-19 09:29:35 2
Asymmetric-Methyl-PABP1 (Arg455/Arg460) (C60A10) Rabbit mAb
 
Resource Report
Resource Website
1+ mentions
Cell Signaling Technology Cat# 3505, RRID:AB_2298971 Asymmetric-Methyl-PABP1 (Arg455/Arg460) (C60A10) Rabbit mAb c, rat, h, hr, m, horse, mouse, r, human, mk Applications: W, IP, IHC-P, IF-IC. Consolidation on 11/2018: AB_10363754, AB_2156885, AB_2298971. monoclonal rabbit AB_2298971 Cell Signaling Technology 3505 2025-08-19 09:29:34 3
CD324 (E-Cadherin) Monoclonal Antibody (DECMA-1), eFluor™ 660, eBioscience
 
Resource Report
Resource Website
1+ mentions
Thermo Fisher Scientific Cat# 50-3249-80, RRID:AB_11043137 CD324 (E-Cadherin) canine, mouse, human Clone DECMA-1 PMID:2419126
PMID:11329369
Applications: Flow, ICC/IF monoclonal rat AB_11043137 Thermo Fisher Scientific 50-3249-80 (also 50-3249) 2025-08-19 09:29:08 1
Anti-ATF4
 
Resource Report
Resource Website
1+ mentions
LSBio (LifeSpan) Cat# LS-B6361-50, RRID:AB_11042790 ATF4 rat, mouse, human vendor suggested use: IgG; IgG ELISA (1:20000), IHC-P (2 µg/ml), WB (1:500); Western Blot; Immunohistochemistry - fixed; Immunohistochemistry; ELISA polyclonal rabbit AB_11042790 LSBio (LifeSpan) LS-B6361-50 2025-08-19 09:29:08 1
Mouse IgG2a kappa Isotype Control (eBM2a), eFluor™ 450, eBioscience
 
Resource Report
Resource Website
1+ mentions
Thermo Fisher Scientific Cat# 48-4724-82, RRID:AB_1272006 Mouse IgG2a kappa not applicable Clone eBM2a Applications: Flow (Assay-Dependent), Ctrl (Assay-Dependent) isotype control mouse AB_1272006 Thermo Fisher Scientific 48-4724-82 2025-08-19 09:29:40 1
Anti-NSD1 Antibody
 
Resource Report
Resource Website
1+ mentions
Antibodies Incorporated Cat# 75-280, RRID:AB_11001827 NSD1 mouse, human N312/10 Applications: ICC
Validation status: IF or IB (Pass), IB in brain (ND), IHC in brain (ND), KO (ND)
This clone is associated with these products: purified (Antibodies Incorporated, Cat# 75-280, RRID:AB_11001827), supernatant (Antibodies Incorporated, Cat# 73-280, RRID:AB_11030251), hybridoma (UC Davis/NIH NeuroMab Facility, Cat# N312/10, RRID:AB_2877552)
monoclonal mouse AB_11001827 Antibodies Incorporated 75-280 2025-08-19 09:29:05 3
Aggrecan ARGxx antibody [BC-3]
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Abcam Cat# ab3773, RRID:AB_304066 Aggrecan ARGxx antibody [BC-3] feline, rat, porcine, canine, cow, pig, horse, rabbit, cat, bovine, human, dog, sheep validation status unknown, seller recommendations provided in 2012: ELISA, IHC-Fr, IHC-P, sELISA, WB; ELISA; Immunohistochemistry - frozen; Immunohistochemistry - fixed; Western Blot; Immunohistochemistry
Info: Independent validation by the NYU Lagone was performed for: IHC. This antibody was found to have the following characteristics: Functional in human:TRUE, NonFunctional in human:FALSE, Functional in animal:FALSE, NonFunctional in animal:FALSE
monoclonal mouse AB_304066 Abcam ab3773 2025-08-19 09:29:19 2
CD28
 
Resource Report
Resource Website
1+ mentions
BD Biosciences Cat# 561368, RRID:AB_11154032 CD28 human Applications: Flow cytometry monoclonal mouse AB_11154032 BD Biosciences 561368 2025-08-19 09:29:46 2
CD183
 
Resource Report
Resource Website
1+ mentions
BD Biosciences Cat# 562266, RRID:AB_11153500 CD183 (CXCR3) mouse Applications: Flow cytometry monoclonal armenian hamster AB_11153500 BD Biosciences 562266 2025-08-19 09:29:46 2
Recombinant Anti-TOMM40 antibody [EPR6932(2)]
 
Resource Report
Resource Website
1+ mentions
Abcam Cat# ab185543, RRID:AB_3095412 TOMM40 human EPR6932(2) Applications: Flow Cyt (Intra), WB, IHC-P, ICC/IF, IP recombinant monoclonal Rabbit AB_3095412 Abcam ab185543 2025-08-19 09:29:47 1
INS antibody
 
Resource Report
Resource Website
1+ mentions
Proteintech Cat# 15848-1-AP, RRID:AB_10597100 INS rat, mouse, human Originating manufacturer of this product.
Applications: IHC, IF, ELISA
polyclonal rabbit AB_10597100 Proteintech 15848-1-AP 2025-08-19 09:29:51 4
CD86-PE, human
 
Resource Report
Resource Website
1+ mentions
Discontinued
Miltenyi Biotec Cat# 130-094-877, RRID:AB_10839702 CD86 non-human primate, human FM95 Discontinued: 11-2018; Target Distribution B cells, dendritic cells, endothelial cells, Langerhans cells, monocytes, T cells; target type CD markers; tested applications MACS Flow Cytometry; quantity:
Info: This product is discontinued and reformatted to a higher concentration for optimized use in multicolor flow cytometry panels. The replacement product cat # is 130-113-572. (RRID:AB_2733843).
monoclonal mouse AB_10839702 Miltenyi Biotec 130-094-877 2025-08-19 09:29:52 2
Anti-OTUD3 polyclonal antibody
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
Atlas Antibodies Cat# HPA028543, RRID:AB_10599302 OTUD3 human Originating manufacturer of this product, immunogen description: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence KGMDSEDDLRDEVEDAVQKVCNATGCSDFNLIVQNLEAENYNIESAIIAVLRMNQGKRNNAEENLEPSGRVLKQCGP; Manufacturer approved use: ICC-IF, IHC, WB polyclonal rabbit AB_10599302 Atlas Antibodies HPA028543 2025-08-19 09:29:51 1
Alexa Fluor(R) 647 anti-human TRA-1-60-R
 
Resource Report
Resource Website
1+ mentions
Rating or validation data
BioLegend Cat# 330606, RRID:AB_1227812 TRA-1-60-R human Clone TRA-1-60-R Applications: FC monoclonal mouse AB_1227812 BioLegend 330606 (also 330605) 2025-08-19 09:29:52 7
Mouse Anti-Gab 1 Monoclonal Antibody, Unconjugated
 
Resource Report
Resource Website
1+ mentions
Santa Cruz Biotechnology Cat# sc-133191, RRID:AB_2107855 Gab1 rat, mouse, human validation status unknown check with seller; recommendations: western blot, ELISA, immunoprecipitation, immunocytochemistry monoclonal mouse AB_2107855 Santa Cruz Biotechnology sc-133191 2025-08-19 09:29:29 3
Alexa Fluor(R) 488 anti-human CD107a (LAMP-1)
 
Resource Report
Resource Website
1+ mentions
BioLegend Cat# 328610, RRID:AB_1227504 CD107a human Clone H4A3 Applications: FC monoclonal mouse AB_1227504 BioLegend 328610 (also 328609) 2025-08-19 09:29:52 3

Can't find your Antibody?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific antibody, it's easier to enter an RRID or a Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your antibody in the search results, please help us by registering it into the system — it's easy. Register it with The Antibody Registry (an Antibody Registry account is required. Create a free Antibody Registry account if you don't have one yet). An RRID will be generated in 1-2 business days.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.